KEGG   Klebsiella pneumoniae Kp52.145: BN49_0847Help
Entry
BN49_0847         CDS       T05281                                 

Gene name
cscA
Definition
(GenBank) similar to sucrose-6-phosphate hydrolase from Escherichia coli (sp|P40714)
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpnk  Klebsiella pneumoniae Kp52.145
Pathway
kpnk00052  Galactose metabolism
kpnk00500  Starch and sucrose metabolism
kpnk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpnk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BN49_0847 (cscA)
   00500 Starch and sucrose metabolism
    BN49_0847 (cscA)
Enzymes [BR:kpnk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     BN49_0847 (cscA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: CDO12608
UniProt: W9B413
Position
865941..867383
Genome map
AA seq 480 aa AA seqDB search
MKMMTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHP
YSTQWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKF
HGDPGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDSWYMIVGAR
EGDTGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAG
FSNRNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFATPDGRRIVIGWLDMWE
SPLPEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVD
NCEAMEVNLRWDCARSSAEQYGLRFGDGLRIYVDAQQQRLVLERHYPQYGLCGTRSVPLT
AGADLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPRRELALFAWSGSAALTEAGAWQLE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgatgacttacacaatctcccgggctgaacaggtactccagacacaacgccag
gcgctgaatctgcgctggtatccgcactatcacctggcggcccgcgccgggtggatcaac
gacccaaacggtctggtgtggttcgacggctggtaccatgccttttatcaacatcacccg
tactccacccagtggggaccgatgcactgggggcacgcgcgcagtaaggatctggtgcac
tgggagcatttgccggtagccctggcgccggagggcccggaggataaagacggctgcttc
tccggctcggcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttc
cacggcgatcctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgc
gacgggatccactttgagcgccaggggatggtggtcgacaccccgccgggtatgcaccac
ttccgtgacccgaaggtctggcgtgagggagatagctggtacatgatcgtcggcgcgcgc
gaaggcgataccggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggac
gcgggggtgctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttc
ttcaccctcaacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcgggg
ttcagcaaccgcaatctgttccagagcggctatctgatcggcgagtggcagccaggccag
cgttttattcgccatggcgaattccgggagatggataacggccacgatttctatgccccg
caaagcttcgccacccccgatggccggcggatcgtgattggctggctggatatgtgggaa
tcgccgctgccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctg
agcctgagcgcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgc
ggcgcctggttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgac
aactgcgaggcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcag
tatggtctgcgctttggcgatggcctgcgcatctacgtggatgcccaacagcagcgtctg
gtgctggagcggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgacc
gccggggcggatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtc
aatgacggcgaagcctgcctgagcagccgtatctatccgcaggctccccgccgtgaatta
gcgttatttgcctggagcggctcggcggcattaaccgaagccggcgcctggcagctcgaa
taa

DBGET integrated database retrieval system