KEGG   Klebsiella pneumoniae Kp52.145: BN49_1347Help
Entry
BN49_1347         CDS       T05281                                 

Gene name
ispA
Definition
(GenBank) highly similar to geranyltranstransferase from Escherichia coli strain UTI89 - UPEC (tr|Q1RFB9)
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
kpnk  Klebsiella pneumoniae Kp52.145
Pathway
kpnk00900  Terpenoid backbone biosynthesis
kpnk01100  Metabolic pathways
kpnk01110  Biosynthesis of secondary metabolites
kpnk01130  Biosynthesis of antibiotics
Module
kpnk_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:kpnk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BN49_1347 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:kpnk01006]
    BN49_1347 (ispA)
Enzymes [BR:kpnk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     BN49_1347 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     BN49_1347 (ispA)
Prenyltransferases [BR:kpnk01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   BN49_1347 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt UbiA
Motif
Other DBs
NCBI-ProteinID: CDO13103
UniProt: A0A0W8AVB2
Position
complement(1387645..1388544)
Genome map
AA seq 299 aa AA seqDB search
MDFPQQLQACVEQANEALRRFIAPQPFQNTPLVEAMHYGALLGGKRLRPFLVYATGEMFG
VCRTTLDAPAAAVECIHAYSLMHDDLPAMDDDDLRRGLPTCHIKFGEANAILAGDALQTL
AFSILSDAPMVDVPDRDRLAMVSELAQASGVAGMCGGQALDLQAEGQQVDLQALERIHRH
KTGALIRAAVRMGALSAGERGRAALPALDRYAENIGLAFQVQDDILDVVGDTATLGKRQG
ADQQLGKSTYPALLGLEQARKKAHDLIADARRSLDELAAQSLDTSALEALANYIIQRDK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggatttcccgcaacaattgcaggcctgtgtggaacaggcaaacgaagcgctgcgccgt
ttcatcgccccgcagccctttcagaacactccgctggtggaagcgatgcattatggcgca
ttgttaggcggtaaacgcctgcgtcccttccttgtctacgccaccggcgagatgttcggc
gtgtgccgtaccacgctggatgctcctgccgcggcggtcgaatgcattcatgcctactcc
ctgatgcatgatgatttgccggcgatggatgatgacgatctgcgccgcggcctgccgacc
tgccatattaaatttggcgaagccaacgcaattcttgcgggagatgccctgcaaacgctg
gcgttctctatactgagtgatgcgccgatggtcgacgttcctgaccgggaccggctggcg
atggtttccgaactggcgcaggccagcggcgtggcgggcatgtgcggcggccaggcgctg
gatctgcaggccgagggacagcaggttgatttacaggcgctggagcgtatccatcgccac
aaaacgggcgccctgatccgcgccgccgtccggatgggagccctgagcgccggcgaacgc
ggccgcgccgccctgcccgcgctggatcgctatgcggaaaatatcggtcttgccttccag
gtccaggatgacattctcgacgtggtaggggatactgcgacccttggcaaacgtcagggt
gccgaccagcaattgggtaaaagcacctatcccgccctcctgggtcttgagcaagcccgg
aagaaagcgcacgacctgatcgctgatgcccgccggtcgttagatgagctggccgcacaa
tctctggatacttcggcactggaagcgctcgcgaattacattattcagcgcgataaataa

DBGET integrated database retrieval system