KEGG   Klebsiella pneumoniae Kp52.145: BN49_3494Help
Entry
BN49_3494         CDS       T05281                                 

Gene name
argS
Definition
(GenBank) highly similar to arginyl-tRNA synthetase from Klebsiella pneumoniae subsp. pneumoniae strain ATCC 700721 - MGH 78578 (sp|A6TB43)
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
kpnk  Klebsiella pneumoniae Kp52.145
Pathway
kpnk00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:kpnk00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN49_3494 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpnk01007]
    BN49_3494 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kpnk03016]
    BN49_3494 (argS)
   03029 Mitochondrial biogenesis [BR:kpnk03029]
    BN49_3494 (argS)
Enzymes [BR:kpnk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     BN49_3494 (argS)
Amino acid related enzymes [BR:kpnk01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BN49_3494 (argS)
Transfer RNA biogenesis [BR:kpnk03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BN49_3494 (argS)
 Prokaryotic type
   Other AARSs
    BN49_3494 (argS)
Mitochondrial biogenesis [BR:kpnk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN49_3494 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: CDO15246
UniProt: W9B9W2
Structure
PDB: 

Position
3629703..3631436
Genome map
AA seq 577 aa AA seqDB search
MNIQALLSEKVSQALIAAGAPADCEPQVRQSAKVQFGDYQANGVMAVAKKLGMAPRQLAE
QVLSHLDLNGIANKVEIAGPGFINIFLDPAFLADNVNRALQSERLGVTKPQAQTIVVDYS
APNVAKEMHVGHLRSTIIGDASVRTLEFLGHKVIRANHVGDWGTQFGMLIAYLEKQQQEN
AGEMALADLEGFYREAKKHYDEDEAFAERARSYVVKLQGGDEYFLQMWRKLVDITMSQNQ
ITYDRLNVTLTRDDVMGESLYNPMLPGIVADLKAKGLAVESEGATVVFLDEYKNKEGEPM
GVIIQKKDGGYLYTTTDIACAKYRYETLHADRVLYYIDSRQHQHLMQAWTIVRKAGYVPD
SVPLEHHMFGMMLGKDGKPFKTRAGGTVKLADLLDEALERARRLVAEKNPDMSADELENL
AKVVGIGAVKYADLSKNRTTDYVFDWDNMLAFEGNTAPYMQYAYTRVLSVFRKAGIDENA
MIDAPVVIAEDREAQLAARLLQFEETLSVVAREGTPHVMCAYLYDLAGLFSGFYEHCPIL
SAESEETRNSRLKLALLTAKTLKLGLDTLGIETVERM
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgaatattcaggctcttctctcagaaaaagtcagccaggccctgatcgcggcaggcgcg
cctgccgattgcgaaccccaggtccgccagtcagcaaaagttcagttcggcgactatcag
gccaacggcgtgatggctgtcgccaaaaagctgggtatggcgccgcgacaacttgcagag
caggtactgtctcatcttgacctcaacggcattgccaacaaggttgaaatcgccgggccg
ggctttatcaatattttcctcgaccccgcgtttctggcggacaacgtcaaccgcgcgctg
cagtctgagcgcctgggcgtcacgaaaccgcaggcgcagactatcgtcgtcgactactcg
gcacccaacgtagcgaaagagatgcacgtcggccatctgcgttcgaccatcattggcgat
gcttcagtccgtaccctggagttcctgggtcataaggtgatccgcgccaaccacgtcggc
gactggggcacccagttcgggatgctgatcgcgtatctggaaaaacagcagcaggaaaac
gccggcgaaatggccctggccgacctcgaaggtttctatcgcgaagcgaaaaagcactat
gacgaagacgaagccttcgccgagcgcgcgcgcagctacgtggttaagctgcagggcggt
gatgagtacttcctgcagatgtggcgtaagctggtcgacatcaccatgtcgcagaaccag
atcacctacgatcgcctgaacgtcaccctgacccgcgatgacgtgatgggtgagagcctg
tacaacccgatgctgccggggatcgtcgccgatctgaaagccaaagggctggcggttgag
agcgaaggcgctaccgtggtcttccttgatgagtacaaaaacaaggaaggcgaaccgatg
ggcgtcatcatccagaaaaaggatggcggctacctctataccaccaccgatatcgcctgt
gcgaagtatcgctatgaaacgctgcacgccgaccgcgtgctctactacatcgactctcgt
cagcaccagcacctgatgcaggcgtggaccatcgtgcgcaaggcaggctacgtgccggac
tccgtgccactggagcaccatatgttcggtatgatgctggggaaagacggcaagccgttt
aaaacccgcgccggcggtaccgtgaagctggcggatctgctggacgaagcgctggagcgc
gcccgtcgcctggtggccgagaagaacccggatatgtcggctgacgagctggaaaatctg
gcgaaagtggtgggtatcggcgcggttaaatatgccgacctgtcgaaaaaccgcaccacc
gactacgtcttcgactgggataatatgctggcgttcgaaggcaacaccgcgccgtatatg
cagtatgcctatacccgcgtgctctccgtgttccgcaaagccggcatcgacgaaaacgcg
atgatcgacgcgccggtggtcatcgccgaagatcgcgaagctcagctggccgcgcgtctg
ctgcagtttgaagagaccctctccgtggtcgctcgcgaagggacgccgcacgtgatgtgc
gcctacctctacgatctggcgggcctgttctccggcttctacgagcactgcccgatcctc
agcgcggaaagcgaagagacccgcaacagccgtctgaagctggcgctgctcacggcgaaa
accctcaagctgggtctcgataccctcggtatcgaaaccgtcgagcgtatgtaa

DBGET integrated database retrieval system