KEGG   Klebsiella pneumoniae Kp52.145: BN49_4600Help
Entry
BN49_4600         CDS       T05281                                 

Gene name
murI
Definition
(GenBank) highly similar to glutamate racemase from Klebsiella pneumoniae strain 342 (sp|B5XZ09)
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
kpnk  Klebsiella pneumoniae Kp52.145
Pathway
kpnk00471  D-Glutamine and D-glutamate metabolism
kpnk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpnk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BN49_4600 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpnk01011]
    BN49_4600 (murI)
Enzymes [BR:kpnk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BN49_4600 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:kpnk01011]
 Precursor biosynthesis
  Racemase
   BN49_4600 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: CDO16332
UniProt: W9BQA9
Position
complement(4898671..4899522)
Genome map
AA seq 283 aa AA seqDB search
MATNLQDGNTPCLAATPSDPRPTVLVFDSGVGGLSVYNEIRQLLPNLHYIYAFDNVAFPY
GEKSEEFIVERVVEIVTAVQQRYPLALAVIACNTASTVSLPALREKFAFPVVGVVPAIKP
AARLTANGIVGLLATRGTVKRPYTHELIDRFANECRIEMLGSAELVELAEAKLHGEPVPL
EELRRILRPWLRMQEPPDTVVLGCTHFPLLQEELQRVLPEGTRLIDSGAAIARRTAWLLE
HEAPDAKSSDENKAFCMALTAETEQLLPVLRRYGFSTLEKLPL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaatctgcaggacgggaatacaccttgtctggcagctacaccttctgatcca
cgtcccaccgtgctggtgtttgattccggcgtcggtgggttgtcggtttataatgagatt
cggcagctgctgccgaatctgcattacatctatgctttcgataacgttgccttcccctat
ggcgagaagagcgaggagtttatcgttgagcgcgttgtggaaatcgtcaccgctgtccag
cagcgttatcccctggcgctggcggtgatcgcctgcaataccgccagtaccgtctccctg
cctgccctgcgtgaaaagttcgctttccccgtcgttggcgtggtgccggcgatcaagccc
gccgcccgtttaacggcgaacggcattgttggcctgctggcgacgcgcggtaccgtaaag
cgtccttatacccatgagctgatcgaccgctttgccaatgaatgtcggattgaaatgctg
gggtcggcggagctggtggagctggcggaagcgaagctgcacggcgagcctgtgccgtta
gaagagctgcgccgtatcctgcgcccgtggctgcggatgcaggagccgccggatacggtg
gtgctgggctgcacccactttcctcttttacaggaggagctgcagcgcgttctgccggaa
ggcacacggctgatcgattccggcgcggcgattgcccgtcgcaccgcctggctgttagag
catgaagcgccggatgcgaagtccagcgacgagaataaggcattctgcatggcgctgacg
gcagaaacagaacagcttttacccgttctgcgtcgctatggcttctcgacgctggaaaaa
ttaccgctctaa

DBGET integrated database retrieval system