KEGG   Klebsiella pneumoniae 34618: LI86_01380Help
Entry
LI86_01380        CDS       T03747                                 

Definition
(GenBank) UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00520  Amino sugar and nucleotide sugar metabolism
kpnu01100  Metabolic pathways
kpnu01503  Cationic antimicrobial peptide (CAMP) resistance
Module
kpnu_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LI86_01380
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LI86_01380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:kpnu01005]
    LI86_01380
Enzymes [BR:kpnu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     LI86_01380
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     LI86_01380
Lipopolysaccharide biosynthesis proteins [BR:kpnu01005]
 Unusual sugar
  LI86_01380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10 NAD_binding_4 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AJB73932
UniProt: A0A081M0N3
Position
292930..294915
Genome map
AA seq 661 aa AA seqDB search
MKAVVFAYHDMGCTGIQSLLDAGYDIAAIFTHPDNPGENHFFGSVARLAAEQGIPVWAPE
DVNHPLWIERIREMKPDVLFSFYYRNLLGDEILNLAPKGAFNLHGSLLPKYRGRAPLNWV
LVNGESETGVTLHRMVNRADAGDIVAQQAVAIGADDAALTLHRKLCAAATELLSRALPAI
LAGTTDERPQDHSQATYVGRRTPEDGRLDWELPAQTLHNLVRAVSDPWPGAFGYAGANKF
IVWKSRVRHDLPAAKPGTVLSIAPLIVACQDGALEIVTGQTERGVYMQGAQLAQALGLVS
GAVISSKPVVAIKRRTRVLILGVNGFIGNHLTERLLQDDNYEIYGLDIGSDAISRFLDCP
RFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKIIRDC
VKYNKRIIFPSTSEVYGMCTDKNFDEDSSNLVVGPINKQRWIYSVSKQLLDRVIWAYGDK
NGLKFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIEGGKQKRCFTDI
SDGIEALFRIIENKDGRCDGQIINIGNPDNEASIKELAEMLLACFERHPLRDRFPPFAGF
REVESSDYYGKGYQDVEHRKPSIRNAKRCLNWEPKVEMEETVEHTLDFFLRTVELVDDKN
P
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagtcttcgcttatcacgatatgggctgcaccggtatccagtccctgctg
gacgccgggtatgatatcgctgctattttcacccacccggataaccctggcgaaaaccat
ttctttggctccgtggcgcgccttgccgccgagcagggtattccggtgtgggccccggaa
gacgtgaaccatccgctgtggattgagcgtatccgcgagatgaagccggacgtgctgttc
tccttctactatcgcaacctgctgggcgatgagatcctcaatctggcgccgaaaggggcg
ttcaacctgcacggttcgctgctgccaaaatatcgcggccgcgcgccgctgaactgggtg
ctggtcaatggcgaaagcgaaaccggcgtcaccctgcaccggatggtgaaccgcgcagac
gctggcgatatcgtcgcccagcaggccgtggcgattggcgcggatgacgccgccctgacg
ctgcatcgtaagctgtgcgctgccgccactgagctgctgagccgggcgctgccggcgatc
ctcgccggcaccaccgatgagcgtccgcaggatcacagccaggcaacctatgtggggcgt
cgtaccccggaagatggccggctggactgggagctgccggcgcagaccctgcacaatctg
gtgcgtgcggtctcggatccgtggccgggcgccttcggctacgccggagcgaacaagttt
atcgtctggaaatcccgcgttcgccacgatttgccagcagctaaaccgggcaccgtgctc
tccattgctccgctgatcgtcgcgtgccaggacggggcgctggagattgtcaccggccag
accgaacgcggcgtgtacatgcagggcgctcagctggcgcaggcgctgggcctggtgtcc
ggggcggtgatcagcagcaaaccggtggtggcgattaagcgtcgcacccgggtgctgatc
ctcggcgtcaacggctttatcggtaaccacctgaccgagcgcctgctgcaggacgacaac
tatgagatttacggtctggatatcggctccgacgccatcagccgttttctcgactgtccg
cgtttccactttgtggaaggcgatatcagcattcactctgagtggatcgagtatcacatt
aagaaatgcgacgtggtgctgccgctggtggccatcgccacgcctatcgaatacacccgc
aacccgctgcgcgtgttcgagctggatttcgaagagaacctgaaaatcatccgcgactgc
gtgaaatacaataagcgcattatcttcccgtcgacctcggaagtgtacggcatgtgcacc
gacaaaaactttgacgaagatagctccaacctggtggtggggccgatcaacaaacagcgc
tggatctactcggtctccaagcagctgctcgatcgcgtgatctgggcctatggcgataag
aacggcctgaagttcacccttttccgtccgttcaactggatggggccgcgtctggataac
cttaatgccgcgcgtatcggtagctcccgcgccatcactcagctgatcctcaacctggtg
gaagggtcgccgatcaagcttatcgaaggcggcaagcagaagcgctgcttcaccgacatc
agcgacggtatcgaagcgctgttccgcatcatcgagaacaaagacggccgctgcgacggg
cagatcattaacatcggcaacccggataacgaagcgagtatcaaagagctggccgaaatg
ctgctcgcctgcttcgaacgtcatccgctgcgcgatcgcttcccgccgttcgccggcttc
cgtgaagtggaaagcagcgattactacggaaagggctaccaggacgttgagcatcgtaag
ccgagcatccgcaacgccaaacgctgcctgaactgggagccgaaggtggagatggaagaa
acggtcgaacacacgctggacttcttcctgcgcacggttgaactggtggacgataaaaat
ccatga

DBGET integrated database retrieval system