KEGG   Klebsiella pneumoniae 34618: LI86_04820Help
Entry
LI86_04820        CDS       T03747                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00052  Galactose metabolism
kpnu00500  Starch and sucrose metabolism
kpnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LI86_04820
   00500 Starch and sucrose metabolism
    LI86_04820
Enzymes [BR:kpnu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LI86_04820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AJB78708
UniProt: A0A1C1RLT6
Position
933770..935203
Genome map
AA seq 477 aa AA seqDB search
MTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDCWYMIVGAREGD
TGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAGFSN
RNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFSTPDGRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVDNCE
AMEVNLRWDCARSSAEQYGLRFGDGLRIYMDAQQQRLVLERHYPQYGLCGTRSVPLTAGA
DLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPRRELALFAWSGAAALTEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacaatctcccgggctgaacaggtactccagacacaacgccaggcgcttaat
ctgcgctggtatccgcactatcacctggcggcccgcgccgggtggatcaacgacccaaac
ggtctggtgtggtttgacggctggtaccatgccttttatcaacatcacccgtactccacc
cagtggggaccgatgcactgggggcacgcgcgcagtaaggatctggtgcactgggagcat
ttgccggtagccctggcgccggagggcccggaggataaagacggctgcttttccggctcg
gcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttccacggcgat
cctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgcgacgggatc
cactttgagcgccaggggatggtggtcgacaccccgccgggtatgcaccacttccgtgac
ccgaaggtctggcgtgaaggagactgctggtacatgatcgtcggcgcgcgcgaaggcgat
accggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggacgcgggggtg
ctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttcttcaccctc
aacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcggggttcagcaac
cgcaatctgttccagagcggctatctgatcggcgagtggcagccaggccagcgttttatt
cgccatggcgaattccgggagatggataacggccacgatttctatgccccgcaaagcttc
tccacccccgatggccggcggatcgtgattggctggctggatatgtgggaatcgccgctg
ccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctgagcctgagc
gcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgcggcgcctgg
ttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgacaactgcgag
gcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcagtatggtctg
cgctttggcgatggcctgcgcatctacatggatgcccaacagcagcgtctggtgctggaa
cggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgaccgccggggcg
gatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtcaatgacggc
gaagcctgcctgagcagccgtatctatccgcaggctccccgccgtgaattagcgttattt
gcctggagcggcgcggcggcattaaccgaagccggcgcctggcagctcgaataa

DBGET integrated database retrieval system