KEGG   Klebsiella pneumoniae 34618: LI86_06640Help
Entry
LI86_06640        CDS       T03747                                 

Definition
(GenBank) histidine kinase
  KO
K07711  two-component system, NtrC family, sensor histidine kinase GlrK [EC:2.7.13.3]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu02020  Two-component system
kpnu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LI86_06640
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LI86_06640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kpnu01001]
    LI86_06640
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kpnu02022]
    LI86_06640
Enzymes [BR:kpnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     LI86_06640
Protein kinases [BR:kpnu01001]
 Histidine kinases
  NtrC family
   LI86_06640
Two-component system [BR:kpnu02022]
 NtrC family
  GlrK-GlrR (amino sugar metabolism)
   LI86_06640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_5 HATPase_c_2 DUF1098 HAMP Clc-like
Motif
Other DBs
NCBI-ProteinID: AJB74932
UniProt: W9BQ11
Position
1297930..1299369
Genome map
AA seq 479 aa AA seqDB search
MIETTSLKRLSLFPRSLRQLVTLSFVLILLPLLVLAWQAWQSLNALSAQAAHINRTTLVD
ARRSEAMINAALEMERSYRQYCVLDDPTLARVYQNQRQRYSQMLDAHAGVLPDEKLWQAL
RQDVSDLAQLQCKNSGPDAQAAARLEVFASNNSDMVQATRAVVYSRGQQLQQEIAERGQF
FGWQALVLFLLSLALVLLFTRMIIGPVKGIERMINQLGAGKSLDDAALFTGPRELRSVGK
RIIWLSERLAWLESQRHQFLRHLSHELKTPLASMREGTELLADRVAGPLTPEQQEIVEIL
DSSSRNLQKLIEQLLDYNRKQADGPVAREAVDLVDLVENVVAAHSLPARAKLMHTELTLQ
ARRCLAEPALLISVMDNLYSNAVHYGAESGNIRIHSYRHGEQVRIDVANSGEPIPAAEKN
MIFEPFYQGSHQRKGAVKGSGLGLSIARDCVRQMQGELSLVDAPAGQVCFRITLPSAPE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgattgagactacatccttgaagcgactctctcttttcccccgttcgctgcgtcagctg
gtgacgctctcttttgtgctgatcctgctgccattgctggtgctggcctggcaggcctgg
cagagcctgaacgcccttagcgcccaggcggcgcatattaaccgtaccaccctggtcgac
gcccgacgcagcgaggcgatgatcaatgccgcactggagatggagcgcagctatcgccag
tactgcgtgctggacgatccgacgctggcgcgcgtctatcaaaaccagcggcagcgctac
agccagatgctggacgcccacgccggcgtgctgccggatgagaagctctggcaggcgctg
cgtcaggatgtcagcgatctggcgcagctgcagtgtaaaaatagcggacccgatgcccag
gcagccgccagactggaagttttcgccagtaataacagcgatatggtgcaggcgacccgg
gcggtcgtctattctcgtggccaacagctgcagcaggagatagccgaacgcggccagttt
tttggctggcaggcgctggtgctgtttctgctgagcctggcgctggtgctactcttcacc
cgcatgattatcggcccggtgaaaggcatcgaaagaatgatcaatcagctgggggcaggg
aagtcgctggacgacgccgcattgtttaccggcccgcgcgagctgcgatcggtgggcaag
cgcatcatctggctcagcgagcgcctggcgtggctggagtcgcagcggcatcaatttctt
cgccatctgtcgcatgagctgaaaaccccgttggccagtatgcgtgaaggtaccgagctg
ttggccgaccgcgtcgcggggcccctgacccctgagcagcaggagatcgtcgagatcctc
gacagcagtagccgtaacctgcaaaagctgattgaacagctgctggactataaccgaaaa
caggccgacggcccggtggctcgcgaagcggtggacctggtggacctggtggaaaacgtc
gtggcggcgcacagcctgcccgcgcgggctaaactgatgcataccgaactgacgctgcag
gcgcggcgttgcctggcagagcctgcgctattgataagcgtaatggataatctctactcc
aatgcggtgcactatggcgctgaatccggtaacatccgtatccatagctaccggcacgga
gagcaggtgcgtattgatgtcgccaacagcggcgaaccgatcccggccgcggaaaaaaac
atgatattcgagcctttttaccaggggagtcaccagcgtaaaggggccgttaagggcagt
ggactggggttgagtatcgcccgcgactgcgtccggcagatgcaaggggagctcagctta
gttgatgcgcccgccgggcaggtctgttttcgcattacgcttccctcagcgccggaataa

DBGET integrated database retrieval system