KEGG   Klebsiella pneumoniae 34618: LI86_13015Help
Entry
LI86_13015        CDS       T03747                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00071  Fatty acid degradation
kpnu00072  Synthesis and degradation of ketone bodies
kpnu00280  Valine, leucine and isoleucine degradation
kpnu00310  Lysine degradation
kpnu00362  Benzoate degradation
kpnu00380  Tryptophan metabolism
kpnu00620  Pyruvate metabolism
kpnu00630  Glyoxylate and dicarboxylate metabolism
kpnu00640  Propanoate metabolism
kpnu00650  Butanoate metabolism
kpnu00900  Terpenoid backbone biosynthesis
kpnu01100  Metabolic pathways
kpnu01110  Biosynthesis of secondary metabolites
kpnu01120  Microbial metabolism in diverse environments
kpnu01130  Biosynthesis of antibiotics
kpnu01200  Carbon metabolism
kpnu01212  Fatty acid metabolism
kpnu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI86_13015
   00630 Glyoxylate and dicarboxylate metabolism
    LI86_13015
   00640 Propanoate metabolism
    LI86_13015
   00650 Butanoate metabolism
    LI86_13015
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LI86_13015
   00072 Synthesis and degradation of ketone bodies
    LI86_13015
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LI86_13015
   00310 Lysine degradation
    LI86_13015
   00380 Tryptophan metabolism
    LI86_13015
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LI86_13015
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LI86_13015
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LI86_13015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpnu04147]
    LI86_13015
Enzymes [BR:kpnu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LI86_13015
Exosome [BR:kpnu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI86_13015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HemY_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AJB76117
UniProt: A0A086IJI6
Position
2599373..2600563
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVIVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAIARAGIAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVVACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLISILTWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEGRFREQILALEVPDGKKATRLFATDEHPRNTPREKLATLRPAFKAD
GVVTAANSSGINDGAAALVMMTRQQAEKRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNIDVQSIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctaatgatattgtgattgtcagcggcgtccgtaccgctattggcacgttt
aacggcagtcttaaacatacccatcagcatgaccttggggccgccgtcattcgcgaagcg
atcgcccgcgccgggattgcgccgcaggatatcgacgaaacgatcgttggcaacgtcggg
caaatcgccgaaagcggttttatcgcccgcatctgtcagctgcgcgcggggatcccgcag
gagagcaccgcctattccgttaaccgccagtgcggctccggacttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggccgaggtggtcgtcgcctgcggcactgaaaat
atgacccagctgccctactacctgcgtaaagcgcgcgatggctatcgcatgggccacggc
gagctggaagatggcctgatctccattctcacctggccggaaggcccttatcacaacggc
atcaccgcggaaaacgtcgcgcaacgcttcggtattacccgcgaagcgatggacgatttc
gcctggtcgagccagcagaaggcgctgaaggcgatcgcggaaggtcgctttcgcgagcag
atcctggcccttgaggtgccggacggcaaaaaagcgacccgcctgtttgcgaccgatgaa
cacccgcgcaacaccccgcgtgaaaagctcgccacgctgcgtccggcgtttaaagccgac
ggcgtggtgacggcggccaactcatcgggcattaacgacggcgcggcggcgctggtgatg
atgacccgccagcaggcggaaaaacgcggcttaaccccgcgcatgcgcattcgcggctgg
gcggtcgccggctgcggagcggagattatggggtttggtccctctcccgctacccgacgc
ctgatggaccgtctcaatatagatgtgcagtccattgatttaattgaactcaacgaggcc
ttcgccgctcaggcgctggcggtgatgaacgatctgcgtcttgacccggcccgcgttaac
gtcaacggcggcgcgatcgccctcggccacccggtaggcgccagcggtgcgattctgccg
gtcaaactgatgtatgaaatggcgcgcagcggcgcacgcactggtctggtcaccatgtgc
atcggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system