KEGG   Klebsiella pneumoniae 34618: LI86_16865Help
Entry
LI86_16865        CDS       T03747                                 

Gene name
putA
Definition
(GenBank) transcriptional regulator
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00250  Alanine, aspartate and glutamate metabolism
kpnu00330  Arginine and proline metabolism
kpnu01100  Metabolic pathways
kpnu01110  Biosynthesis of secondary metabolites
kpnu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LI86_16865 (putA)
   00330 Arginine and proline metabolism
    LI86_16865 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:kpnu03000]
    LI86_16865 (putA)
Enzymes [BR:kpnu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     LI86_16865 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     LI86_16865 (putA)
Transcription factors [BR:kpnu03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    LI86_16865 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AJB76844
UniProt: W9BFS6
Position
3324040..3328002
Genome map
AA seq 1320 aa AA seqDB search
MGTTTMGVKLDDATRERIKSAASRIDRTPHWLIKQAIFNYLEKLENDETLPELPALLSGA
ANESDDASEPTEEPYQPFLEFAEQILPQSVSRAAITAAWRRPETDAVPMLLEQARLPQPL
GEQAHKLAYQLAEKLRNQKTASGRAGMVQSLLQEFSLSSQEGVALMCLAEALLRIPDKAT
RDALIRDKISNGNWQSHIGRSPSLFVNAATWGLLFTGKLVSTHNETSLSRSLNRIIGKSG
EPLIRKGVDMAMRLMGEQFVTGETIAEALANARKLEEKGFRYSYDMLGEAALTAADAQAY
MVSYQQAIHAIGKASNGRGIYEGPGISIKLSALHPRYSRAQYDRVMEELYPRLKSLTLLA
RQYDIGINIDAEEADRLEISLDLLEKLCFEPELAGWNGIGFVIQAYQKRCPFVIDYLIDL
ATRSRRRLMIRLVKGAYWDSEIKRAQMEGLEGYPVYTRKVYTDVSYLACAKKLLAVPNLI
YPQFATHNAHTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYEQVVGKVADGKLNRPCRIY
APVGTHETLLAYLVRRLLENGANTSFVNRIADNTLPLDELVADPVSAVEKLAQQEGQAGL
PHPKIPLPRDLYGSGRSNSAGLDLANEHRLASLSSSLLNSALHKWQALPMLEQPVAEGEM
QPVVNPAEPKDIVGYVREASDAEVQQALTSAINNAPIWFATPPQERAAILERAAVLMESQ
MPTLMGILVREAGKTFSNAIAEVREAVDFLHYYAGQVRDDFDNETHRPLGPVVCISPWNF
PLAIFTGQIAAALAAGNSVLAKPAEQTPLIAAQGVAILLEAGVPPGVIQLLPGRGETVGA
ALTSDERVRGVMFTGSTEVATLLQRNIASRLDPQGRPTPLIAETGGMNAMIVDSSALTEQ
VVIDVLASAFDSAGQRCSALRVLCLQEEVADHTLTMLRGAMSECRMGNPGRLTTDIGPVI
DAEAKENIERHIQAMRAKGRTVYQAVRENSEDAREWRHGTFVPPTLIELDSFDELKKEVF
GPVLHVVRYNRNELDKLVEQINASGYGLTLGVHTRIDETIAQVTGSAKVGNLYVNRNMVG
AVVGVQPFGGEGLSGTGPKAGGPLYLYRLLSSRPQDAVGVTFARQDAERPLDAQLKTLLE
KPLQALQQWAAGRPELQALCQQYSEQAQSGTQRLLPGPTGERNTLTLMPRERVLCVADNE
QDALIQLAAVLAVGCEVLWPDSALQRDLAKKLPREVSERIRFAKAEQLPGQAFDAVIYHG
DSDQLRELCEQVAARDGAIVSVQGFARGETNLLLERLYIERSLSVNTAAAGGNASLMTIG
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccaccaccatgggtgttaagcttgacgacgcaacccgcgagcgcattaaatcc
gccgcgagccgtattgaccgcacgccgcactggctgattaagcaggccatctttaattat
ctggaaaaactggagaacgacgagacgctgcctgagctgccggccctgctctccggggcc
gccaacgaaagcgatgacgccagcgaaccaacggaagagccctatcagccgttcctcgaa
ttcgccgagcagatcctgccgcagtcggtgagccgcgcggcgatcaccgccgcctggcga
cgtccggaaaccgacgcggtaccgatgctgctggagcaggcccgtctgccgcagccgctg
ggcgaacaggcgcacaagctggcgtatcagctggcggaaaaactgcgcaaccagaaaacc
gccagcggccgcgccggcatggtgcagagcctgctgcaggagttctccctctcttcacag
gaaggggtggcgctgatgtgcctggcggaagccctgctgcgtattccggataaagccacc
cgcgatgcgctgatccgcgacaaaatcagcaacggcaactggcagtcgcacatcggccgc
agcccgtcgctgttcgtcaacgccgccacctgggggctgctgttcaccggaaaactggtg
tcgacccataacgagaccagcctctcccgctccctgaaccgcatcatcggcaagagcggc
gaaccgctgatccgcaaaggcgtggatatggcgatgcgcctgatgggcgagcagttcgtc
accggggaaaccatcgccgaagcgctggccaacgcccgcaagctggaagaaaaagggttc
cgctactcctacgatatgctcggcgaagccgccctgaccgccgctgacgcccaggcctat
atggtttcttatcagcaggcgatccatgccatcggcaaagcctccaacggccgcggcatt
tatgaaggtccgggtatctccattaagctctccgcgctgcacccgcgctacagccgcgcg
cagtatgaccgggtgatggaagagctttacccgcggctgaaatcgctgaccctgctggcg
cgccagtatgacatcggcatcaatattgacgccgaagaggcagaccgtctggagatctcc
ctcgacctgctggaaaaactgtgcttcgagccggaactggccggctggaacgggattggc
ttcgtgattcaggcctaccagaagcgctgtccgtttgtcattgattacctgattgacctc
gccacccgcagccgccgtcgcctgatgatccgtctggtgaaaggcgcctactgggatagc
gaaattaaacgcgcgcagatggaaggtctcgaaggctatccggtatacacccgcaaggtt
tacaccgacgtctcctacctcgcctgcgcgaagaagctgctggcggtgccgaacctgatt
tacccgcagttcgccacccataacgctcatactctggcggctatctaccagctggcgggc
cagaactactacccgggccagtatgagttccagtgcctgcacggcatgggcgaaccgctg
tacgagcaggtggtgggcaaggtcgccgacggcaaactgaaccggccgtgccgcatctac
gccccggtgggcacccacgagacgctgctggcgtatctggtgcgtcgtctgctggagaac
ggcgccaatacctctttcgtcaaccgtatcgcggacaataccctgccgctggacgagctg
gtggccgacccggtcagcgcggtagaaaaactggcgcagcaggaaggccaggccggcctg
ccgcatccgaaaatcccgctgccgcgcgatctctacggcagcggccggagcaactccgcc
ggtctcgatctggcgaacgagcaccgtctggcctccctctcctcttccctgctcaacagc
gcgctgcataaatggcaggcattgccgatgctggagcagccggtggccgaaggcgagatg
cagccggtggttaacccggcagagccgaaagatatcgtcggctacgtccgcgaagccagc
gacgctgaagtgcagcaggcgctgaccagcgctatcaacaatgcgccgatctggttcgcc
actccgccgcaggagcgcgccgccattcttgagcgcgccgcggtgctgatggaaagccaa
atgccgaccctgatggggatcctggtgcgcgaggcgggtaaaaccttcagcaacgccatc
gctgaagtgcgcgaagccgttgacttcctgcactattacgccggccaggtgcgcgacgat
ttcgataatgaaactcaccgcccgctgggtccggtggtctgtatcagcccgtggaacttc
ccgctggcgatcttcaccggccagattgccgccgcgctggcggccggcaacagcgtgctg
gcgaaacctgccgagcagacgccgcttatcgccgcccagggcgtggcgattctgctggaa
gccggcgtgccgccgggcgttattcaactgctgccgggccgcggggagaccgtgggcgcc
gcgctaacctccgatgagcgcgtgcgcggcgtgatgttcaccggctccaccgaagtggcc
accctgctgcagcgcaatatcgccagccgcctcgatccccagggccgcccgacgccgctg
atcgccgaaaccggcgggatgaacgcgatgatcgtcgattcgtcggcgctcaccgagcag
gtagtgatcgacgtgctggcttccgcgttcgacagcgccggccagcgctgctccgccctg
cgcgtgctttgcctgcaggaagaggtcgccgatcacaccttaaccatgctgcgcggcgcc
atgagcgagtgccggatgggcaatccggggcgcctgaccaccgatatcggtccggttatc
gatgcggaagcgaaagagaatatcgaacgccatattcaggcgatgcgcgccaaaggccgc
accgtctaccaggcggtgcgtgagaatagcgaagacgcccgcgaatggcgtcacgggacc
ttcgtgccgccgacgcttatcgagctcgacagcttcgacgagctgaaaaaagaggtcttc
ggcccggtactgcacgtggtgcgctataaccgtaacgagctggacaaactggtcgagcag
attaacgcctctggctacggcctgaccctcggcgtgcatacccgtatcgacgaaaccatc
gcccaggtcaccggcagcgccaaggtgggcaacctgtacgtcaaccgcaatatggttggc
gcggtggtcggcgttcagccgttcggcggcgaagggttgtccggtaccggtccgaaagcc
ggcggtccgctgtatctgtaccgtctgctctccagccgtccgcaggacgcggttggcgtg
accttcgcccgccaggatgcagagcgtccgctggacgcccagctgaaaacgctgctggaa
aaaccgctgcaggcgctgcagcagtgggccgcgggccgtcctgagctgcaggcgctgtgc
cagcagtacagcgagcaggcgcaaagcggcactcaacgcctgctgccggggccaaccggc
gagcgcaacaccctgacgctgatgccgcgcgagcgcgtgctgtgcgtagcggataacgaa
caggatgcgctgatccagctggcggctgtgctggcggtgggttgtgaagtactgtggccg
gacagcgccctgcagcgcgatctggcgaagaaactgccgcgggaggtcagcgagcgcatt
cgctttgccaaagcggagcagttgcctggccaggccttcgacgcggttatctaccacggc
gattccgaccagctgcgcgagctgtgcgagcaggtggcggcgcgcgatggggcgattgtc
tccgtgcagggcttcgcccgcggcgaaaccaatctgctgctggagcggctgtatatcgag
cgttcgctgagcgttaacaccgcggcggcaggcggtaacgccagcctgatgaccatcggc
taa

DBGET integrated database retrieval system