KEGG   Klebsiella pneumoniae 34618: LI86_17530Help
Entry
LI86_17530        CDS       T03747                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00260  Glycine, serine and threonine metabolism
kpnu01100  Metabolic pathways
kpnu01110  Biosynthesis of secondary metabolites
kpnu01120  Microbial metabolism in diverse environments
kpnu01130  Biosynthesis of antibiotics
kpnu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LI86_17530
Enzymes [BR:kpnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     LI86_17530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AJB76968
UniProt: A0A080SJ12
Position
3476659..3477660
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPGRAMLEAMMAAPVGDDVYGDDPTVNELQRYAADLAGKEAALFLPTGTQ
ANLVGLLSHCQRGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAADGSLPLDKVAAKI
KPDDIHFAPTRLLSLENTHNGKVLPRDYLQEAWAFTRQRNLALHVDGARIFNAVVAYGCE
LRDIAQYCDSFTICLSKGLGAPVGSLLLGSEAYIRRAVRWRKMVGGGMRQAGILAAAGLY
ALKNNVQRLQEDHDNAAWMAEQLRAIGADVTRNDTNMLFVRVGEEQAPALGKFMQAQGVL
INASPVVRLVTHLDVNRQQLSEVVAHWQAFLQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatttacgcagtgataccgttacccgtcccgggcgcgccatgctggaggccatg
atggccgccccggtcggggacgatgtgtatggcgacgaccctaccgtcaatgaactgcag
cgctatgccgccgacctggccggcaaagaagcggcgctatttctacccaccggcacccag
gccaatctcgttggcctgctcagccattgccagcgcggcgaagagtatatcgtcggccag
ggggcgcataactatctgtacgaagccggcggcgcggcggtcctcggcagtattcagccg
cagccgatcgacgccgcggcggatggttcgctgccgctggataaagtggcggcgaaaatc
aaacccgacgatatccattttgcccccacccgcctgctgagcctggaaaacacccataac
ggtaaggtgctgccgcgcgactatctgcaggaagcctgggcgtttacccgccagcgcaat
ctggcgctgcacgtcgacggcgcgcgcatctttaacgccgtggtggcctacggctgcgag
ttacgcgatatcgcccaatactgcgactccttcaccatctgcctgtcaaaggggcttggc
gctccggtaggctcgctgctgctcggcagcgaggcgtacattcgccgcgccgtccgctgg
cggaaaatggtcggtggcgggatgcgccaggcgggcatcctggccgccgccgggctgtac
gcgctgaaaaataacgtgcagcgcctgcaggaggatcatgacaacgccgcgtggatggcg
gagcagctgcgcgctatcggcgccgacgtcacccgtaacgataccaacatgctgttcgtt
cgcgtcggcgaagagcaggccccggcgctcggcaagtttatgcaggcgcagggggtattg
attaacgcctcgcctgttgtccgtctggtcactcacctggatgtcaaccgtcagcagctg
agcgaggtggtcgcccactggcaggcttttttacaacgctaa

DBGET integrated database retrieval system