KEGG   Klebsiella pneumoniae 34618: LI86_18405Help
Entry
LI86_18405        CDS       T03747                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00020  Citrate cycle (TCA cycle)
kpnu00310  Lysine degradation
kpnu00380  Tryptophan metabolism
kpnu01100  Metabolic pathways
kpnu01110  Biosynthesis of secondary metabolites
kpnu01120  Microbial metabolism in diverse environments
kpnu01130  Biosynthesis of antibiotics
kpnu01200  Carbon metabolism
Module
kpnu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpnu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LI86_18405
  09105 Amino acid metabolism
   00310 Lysine degradation
    LI86_18405
   00380 Tryptophan metabolism
    LI86_18405
Enzymes [BR:kpnu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LI86_18405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: AJB77124
UniProt: A0A0W8ASF6
Position
complement(3643480..3644706)
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGATVLSRQILGRLREGNSAGKESSEKADAKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDPAAIKGTGVGGRLTREDVEKHLAKAPAPAEAKAPAAAPAAAPAPQLGHRSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSF
YVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDLLGMADIEK
NIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VNGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcccgacctgcctgagtccgtagctgacgcaaccgtc
gccacctggcacaaaaaaccgggcgacgcggtcgtccgtgacgaagttctggtcgaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcattctggatgcagtg
ctggaagacgagggcgccaccgtcctgtctcgccagatccttggccgcctgcgcgaaggc
aacagcgcaggtaaagaaagcagcgagaaagccgatgcgaaagcgtccactccggcgcag
cgtcagcaggcctctctggaagagcagaacaacgacgcgctgagcccggcgatccgtcgt
ctgctggctgaacacaaccttgacccagcggccatcaaaggcactggcgtcggcggtcgt
ctgacccgcgaagacgttgagaaacatctggcgaaagccccggcgccggcagaagccaaa
gcgccagccgccgccccggcagccgcgccggcgccgcagctgggccaccgttcggaaaaa
cgcgtcccgatgacccgtctgcgtaaacgcgtagccgaacgtctgctggaagcgaaaaac
tctaccgccatgctgacgacctttaacgaagtcaacatgaagcccatcatggatctgcgt
aagcagtacggtgaggcgttcgaaaaacgtcatggcatccgcctgggctttatgtccttc
tacgtgaaagcggtagtggaagcgctgaaacgctatccggaagtgaacgcttccatcgat
ggcgacgacgtggtgtaccacaactacttcgacgtcagcatggccgtatccactccgcgc
ggtctggtcaccccggtgctgcgtgacgtcgacctgctgggcatggcggatatcgaaaag
aatatcaaagagctggcagtgaaaggccgcgacggcaagctgaccgtagacgacctgacc
ggcggtaacttcactattaccaacggcggcgtcttcggctccctgatgtccacgccgatc
atcaacccaccgcagagcgctattctgggtatgcatgccattaaagaccgtccgatggcg
gtcaatggcaaggtagagatcctgccgatgatgtacctggcgctctcctatgaccaccgt
ctgatcgacggacgtgaatcggtaggcttcctggtggcgattaaagagctgctggaagat
ccgacccgtctgctgctggacgtgtag

DBGET integrated database retrieval system