KEGG   Klebsiella pneumoniae 34618: LI86_22615Help
Entry
LI86_22615        CDS       T03747                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00620  Pyruvate metabolism
kpnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI86_22615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpnu02000]
    LI86_22615
Enzymes [BR:kpnu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     LI86_22615
Transporters [BR:kpnu02000]
 Other transporters
  Primary active transporters [TC:3]
   LI86_22615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 FliO
Motif
Other DBs
NCBI-ProteinID: AJB77918
UniProt: A0A0T5ID64
Position
4492875..4494659
Genome map
AA seq 594 aa AA seqDB search
MTVAITDVVLRDAHQSLFATRLRLDDMLPVAAQLDDVGYRSLECWGGATFDACIRFLGED
PWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMQPALQAVRRHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSVAIKDMSGILT
PHAAFELVSEIKKRYDVTLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTPYDTGLDIHRLESIAAYFREVRKKYHAFEGQLKGTDSRILVAQVPGGML
TNLEGQLKQQSAAHRLDEVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLGGERYKTI
AKETAGILKGEYGRTPAPVNAALQARVLDGADPVTCRPADLLKPELAQLEADVKRQAQEK
GITLAENAIDDVLTVALFPQPGLKFLENRHNPAAFEPVPQAEAAQPVAKAEKPAASGVYT
VEVEGKAFVVKVSDGGDVSQLTAAAPAPAPAPASAPAAAAPAGAGTPVTAPLAGTIWKVL
ASEGQTVAAGEVLLILEAMKMETEIRAAQAGTVRGIAVKAGDAVAVGDTLMTLA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgccattaccgatgtcgtcctgcgcgacgcccaccagtccctgttcgccacc
cgtctgcgtctcgacgatatgctgcccgttgccgctcagctggacgacgtcggctaccgc
tcgctggagtgctggggcggcgccacctttgacgcctgcatccgcttcctcggcgaggac
ccgtgggtccgcctgcgcgagctgaaaaaggcgatgcccaagaccccgctgcagatgctg
ctccgcggccagaacctgctcggctaccgccactacgccgacgacgtggtggagcgcttc
gtcgagcgcgccgtcaaaaacggcatggacgtcttccgcgtcttcgatgccatgaacgac
ccgcgcaacatgcagcccgccctgcaggcggtccgccgccacggcgcccacgcccagggt
acgctttcgtacaccaccagcccggcgcacaccctgcagacctggctcgacctcaccgaa
cagctgctggagaccggcgttgactccgtcgccatcaaggacatgtccggcattctgacg
ccgcatgccgcctttgagctggtcagcgaaatcaagaagcgctatgacgtcaccctgcac
ctgcactgccacgccaccaccgggatggcggagatggcgctgctgaaggccattgaagcc
ggggtcgacggcgtggatacggcgatttcgtccatgagcgccacctatggccacccggcc
accgaagcgctggtggccaccctcgccggcacgccgtacgacaccggcctcgatatccac
aggctggagagcatcgccgcctacttccgcgaggtgcgcaaaaaataccacgccttcgaa
ggccagctgaagggcaccgacagccgtatcctcgtcgcccaggtgccgggcgggatgctc
accaaccttgaaggccagctgaagcagcagagcgccgcccaccgtctggatgaagtactg
gcggaaatcccccgcgtgcgcgaggacctcggcttcatcccgctggtgaccccgacctcg
cagattgtcggcacccaggcggtgctcaacgtgctgggcggcgagcgctacaaaaccatc
gcgaaggagaccgccggtatcctgaaaggcgagtacggccgcaccccggccccggtgaac
gccgccctgcaggcgcgggtgctcgacggcgccgacccggtgacctgccgcccggccgac
ctgctgaagccggagctggcgcagctggaagcggatgtgaaacgccaggcacaggagaag
ggcatcacgcttgccgaaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcaa
cccggcctgaagttcctcgaaaaccgccacaacccggcggcctttgagccggtaccgcag
gcggaagccgcgcagccagtggcaaaagcagaaaaacctgccgcctccggcgtctacacc
gtggaggtggaaggcaaagcctttgtggtcaaagtcagcgacggcggtgacgtcagccag
ctgacggcggctgctccggctcctgctcctgctcctgcctctgcacccgccgctgccgcc
ccggccggcgccggtaccccggtgaccgccccgctggcgggcactatctggaaggtgctg
gccagcgaaggccagacggtggccgcaggcgaagtgctgctgattctggaagccatgaag
atggaaaccgaaatccgcgccgcgcaggccgggaccgtgcgcggtatcgcggtgaaagcc
ggtgacgcggtggcggtcggcgacaccctgatgactctggcgtaa

DBGET integrated database retrieval system