KEGG   Klebsiella pneumoniae 34618: LI86_23810Help
Entry
LI86_23810        CDS       T03747                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00220  Arginine biosynthesis
kpnu01100  Metabolic pathways
kpnu01110  Biosynthesis of secondary metabolites
kpnu01130  Biosynthesis of antibiotics
kpnu01230  Biosynthesis of amino acids
Module
kpnu_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    LI86_23810
Enzymes [BR:kpnu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     LI86_23810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N IFRD
Motif
Other DBs
NCBI-ProteinID: AJB78139
UniProt: A0A060VPI5
Position
4728152..4729156
Genome map
AA seq 334 aa AA seqDB search
MSAFYQKHFLKLLDFTPAEITALLELAAKLKADKKNGIEVQKLAGKNIALIFEKDSTRTR
CSFEVAAYDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGIQYRGHGQEVVETLAQY
AGVPVWNGLTNEFHPTQLLADLLTMKEHLPGKAFNQMTLVYAGDARNNMGNSMLEAAALT
GLDLRLVAPSACWPEAALVETCTALAKQQGGNITLTEDIAAGVKGADFIYTDVWVSMGEA
KEKWAERIALLRDYQVNSAMLALTGNPQVKFLHCLPAFHDDQTTLGKQMAADYGLHGGME
VTDEVFESAASVVFDQAENRMHTIKAVMVATLSR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgttttaccagaagcattttttaaagttactcgattttacgcctgcagaaatc
accgccctgctcgagctggcggcaaagctgaaagccgataagaaaaacggtatcgaagtc
cagaaactggcaggaaaaaacatcgcgctcatcttcgaaaaagactcaacccgtacacga
tgctctttcgaagttgccgcatacgatcaaggcgcccgcgtgacctatctggggcccagc
ggtagccagattggccataaagagtcgatcaaggacaccgcccgcgtgctcggacggatg
tacgacggcattcagtaccgcggccacggccaggaagtggtagagaccctggcgcaatac
gccggcgtgccggtgtggaacggcctcaccaacgagttccaccccacccagctgctggcg
gacctgctgaccatgaaagagcatctgccgggcaaagcctttaaccagatgacgctggtc
tacgccggcgacgcgcgcaacaacatgggcaattcgatgctggaagccgccgccttgacc
ggtctggatctgcgcctggtggcgccatcggcctgctggccggaggccgcgctggtggag
acctgcaccgcgctggccaaacagcagggcggcaacatcaccctgacggaagatatcgcc
gcgggggtgaaaggcgccgattttatctataccgacgtctgggtctcaatgggcgaggcg
aaggaaaaatgggccgaacgtatcgccctgctgcgcgactatcaggttaacagcgcgatg
ctggcgctcaccggcaacccgcaggtcaagttcctccactgcctgccggcgttccacgac
gatcagaccacgctgggcaaacagatggctgccgattacggcctgcacggcggcatggag
gtgactgacgaggtgtttgagtcggcggcgagcgtggtcttcgaccaggcggaaaaccgg
atgcacaccatcaaagcggtgatggtggcgacgctttcacgctga

DBGET integrated database retrieval system