KEGG   Klebsiella pneumoniae 34618: LI86_25140Help
Entry
LI86_25140        CDS       T03747                                 

Gene name
malF
Definition
(GenBank) maltose transporter membrane protein
  KO
K10109  maltose/maltodextrin transport system permease protein
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LI86_25140 (malF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpnu02000]
    LI86_25140 (malF)
Transporters [BR:kpnu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    LI86_25140 (malF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MalF_P2 BPD_transp_1 TM_PBP2_N DUF3339 DUF4534
Motif
Other DBs
NCBI-ProteinID: AJB78388
UniProt: W9BEI1
Position
4982644..4984188
Genome map
AA seq 514 aa AA seqDB search
MDAVKKRHWWQSPQLTWSVIGLLCLLVGYLVVLMYAQGEYLFAIMTLILSSVGLYIFANR
KAYAWRYVYPGLAGMGLFVLFPLICTIAIAFTNYSSTNQLTFERAQQVLMDRSFQAGKAY
NFTLIPAGDEWKLALTDGESGKNYLSDAFKFGGEQKLALKETDALPEGERANLRVITQNR
TALNQLTAVLPDDSKVIMSSLRQFSGTQPLYTLGEDGVLTNNQTHVKYRPNNDVGFYQSI
NADGSWGNEKLSPGYTVTIGWDNFTRVFHDEGIQKPFFAIFVWTVVFSVLTVVLTVAVGM
ILACLVQWEALKGKAIYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSTLFGIKPA
WFSDPTTARTMIIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITFP
LLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVSYTYRIAFEGGG
GQDFGLAAAIATLIFLLVGALAIVNLKATRMKFD
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggatgccgttaaaaagagacactggtggcaaagcccgcaactcacatggtctgtgatt
ggcttactgtgcctgctggtgggttaccttgttgttttgatgtacgcccagggggagtac
ctgttcgccatcatgacgctgattttaagctcagttggcctgtatattttcgctaatcgc
aaggcttatgcctggcgctatgtttatcccggcctcgccggcatgggcctgtttgtcctg
tttccgctgatctgcactatcgctatcgcgtttaccaactacagtagcaccaaccagctg
acctttgagcgtgcgcagcaggtgctgatggatcgttccttccaggccggcaaagcctat
aatttcacgctgatccctgcgggtgacgagtggaagctggcgctgaccgacggcgaaagc
ggtaaaaactacctttctgacgcctttaaatttggcggcgagcagaagctggcgttaaaa
gaaaccgacgccctgccggaaggcgagcgcgccaacctgcgcgtgattacccagaatcgc
accgcgctgaaccagctgaccgctgtgctgccggatgacagcaaagtcatcatgagctcc
ctgcgccagttctccggtacccagcctctgtataccctcggcgaagacggggtactgacc
aacaatcagacccacgttaaataccgcccgaacaacgacgtcggcttctaccagtcaatt
aacgccgacggcagctggggcaatgagaagctgagcccgggctacactgtgactatcggc
tgggacaactttacccgcgtcttccacgatgaaggcattcagaaaccgttcttcgcgatc
ttcgtctggacggtggtgttctcggtgctgaccgtggtgctgaccgtcgcggtggggatg
atcctcgcctgcctggtgcagtgggaagcgctgaaaggcaaagcgatttatcgcgtcctg
ctgattctgccgtacgccgtaccgtcgtttatttcgattctgattttcaaagggctgttc
aaccagagctttggtgaaatcaacatgatgctcagcacgctgttcggcattaagccggcc
tggtttagcgacccgaccaccgcgcgcaccatgatcatcatcgtcaacacctggctgggc
tacccgtacatgatgatcctgtgcatggggctgctgaaggcgattccggacgatctgtac
gaagcgtcggcaatggatggcgccggcccgttccagaacttctttaaaattaccttcccg
ctgctgattaagccgctaacgccgctgatgatcgccagcttcgcctttaactttaacaac
ttcgtcctgattcaattgttgaccaacggcggtccggaccgtctcggcaccaccaccccg
gccggttataccgacctgctggtgagctacacctatcgcatcgcctttgaaggcggcggc
ggtcaggacttcggcctggcggcggctatcgcaacgcttatcttcctgctggttggcgcg
ttagcgattgtgaatctgaaagccacgcgcatgaagtttgattaa

DBGET integrated database retrieval system