KEGG   Klebsiella pneumoniae 34618: LI86_26090Help
Entry
LI86_26090        CDS       T03747                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
kpnu  Klebsiella pneumoniae 34618
Pathway
kpnu00670  One carbon pool by folate
kpnu01100  Metabolic pathways
kpnu01120  Microbial metabolism in diverse environments
kpnu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kpnu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LI86_26090 (metF)
Enzymes [BR:kpnu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     LI86_26090 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AJB78551
UniProt: W9BJ75
Position
complement(5179194..5180081)
Genome map
AA seq 295 aa AA seqDB search
MSFFHANQREALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWKSIDRLSSLKPKFVSVTY
GANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASRDELRTIAQDYWNNGIRHIVALRGD
LPPGSGKPDMYAADLVTLLKEVGDFDISVAAYPEVHPEAKSAQADLLNLKRKVEAGANRA
ITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPVWMSKMFE
GLDNDAETRQLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttttcacgccaatcagcgggaagccctgaatcagagcctggcggaagtccag
ggccagattaatgtgtcttttgaattctttccgccgcgcaccagtgaaatggagcaaacc
ctgtggaaatccatcgatcgcctgagcagtctgaaaccgaagtttgtttcggtaacctat
ggcgcgaactctggcgagcgcgatcgcacccacagcatcatcaaaggcattaaagagcga
actggtctggaagcagcgccgcacctgacctgtatcgatgccagccgcgatgagttgcgc
actatcgctcaggattactggaacaacggtatccgccatatcgtcgccctgcgcggcgac
ctgccgccgggcagcggtaaaccggatatgtacgccgccgatctggtgacgttgctgaaa
gaggtaggcgattttgatatctctgtcgccgcgtatccggaagtgcatccggaggcgaaa
agcgcgcaggcggatttactgaacctgaaacgcaaagtagaagcaggggccaaccgcgcg
atcacccagttcttcttcgatgtggaaagctacctgcgttttcgcgatcgctgcgtctcg
gcaggcatcgacgtggaaatcattcccggtatcctgccggtctccaactttaaacaggcg
aaaaagtttgcggatatgaccaatgtccgtatcccggtgtggatgtcaaaaatgttcgaa
gggctggataacgacgccgaaacccgtcaactggtgggggcgaatatcgccatggacatg
gtgaagatcttaagccgggaaggggtcaaggatttccacttctacaccctgaaccgcgcc
gagatgagctacgccatctgccatacgctgggcgtacgcccggcctga

DBGET integrated database retrieval system