KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_06515Help
Entry
KPN2242_06515     CDS       T01982                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00020  Citrate cycle (TCA cycle)
kpo00310  Lysine degradation
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01120  Microbial metabolism in diverse environments
kpo01130  Biosynthesis of antibiotics
kpo01200  Carbon metabolism
Module
kpo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPN2242_06515
  Amino acid metabolism
   00310 Lysine degradation
    KPN2242_06515
Enzymes [BR:kpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KPN2242_06515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: AEJ97221
Position
1382679..1383905
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGATVLSRQILGRLREGNSAGKESSEKADAKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDPAAIKGTGVGGRLTREDVEKHLAKAPAPAEAKAPAAAPAAAPAPQLGHRSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSF
YVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDLLGMADIEK
NIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VNGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcccgacctgcctgagtccgtagctgacgcaaccgtc
gccacctggcacaaaaaaccgggcgacgcggtcgtccgtgacgaagttctggtcgaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcattctggatgcagtg
ctggaagacgagggcgccaccgtcctgtctcgccagatccttggccgcctgcgcgaaggc
aacagcgcaggtaaagaaagcagcgagaaagccgatgcgaaagcgtccactccggcgcag
cgtcagcaggcctctctggaagagcagaacaacgacgcgctgagcccggcgatccgtcgt
ctgctggctgaacacaaccttgacccagcggccatcaaaggcactggcgtcggcggccgt
ctgacccgcgaagacgttgagaaacatctggcgaaagccccggcgccggcagaagccaaa
gcgccagccgccgccccggcagccgcgccggcgccgcagctgggccaccgttcggaaaaa
cgcgtcccgatgacccgcctgcgtaaacgcgtagccgaacgtctgctggaagcgaaaaac
tctaccgccatgctgacgacctttaacgaagtcaacatgaagcccatcatggatctgcgt
aagcagtacggtgaggcgttcgaaaaacgtcatggcatccgcctgggctttatgtccttc
tacgtgaaagcggtagtggaagcgctgaaacgctatccggaagtgaacgcttccatcgat
ggcgacgacgtggtgtaccacaactacttcgacgtcagcatggccgtatccactccgcgc
ggtctggtcaccccggttctgcgtgacgtcgacctgctgggcatggcggatatcgaaaag
aatatcaaagagctggcagtgaaaggccgcgacggcaagctgaccgtagacgacctgacc
ggcggtaacttcactattaccaacggcggcgtcttcggctccctgatgtccacgccgatc
atcaacccaccgcagagcgctattctgggtatgcatgccattaaagaccgtccgatggcg
gtcaatggcaaggtagagatcctgccgatgatgtacctggcgctctcctatgaccaccgt
ctgatcgacggacgtgaatcggtaggcttcctggtggcgattaaagagctgctggaagat
ccgacccgtctgctgctggacgtgtag

DBGET integrated database retrieval system