KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_06800Help
Entry
KPN2242_06800     CDS       T01982                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00780  Biotin metabolism
kpo01100  Metabolic pathways
Module
kpo_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KPN2242_06800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpo01007]
    KPN2242_06800
Enzymes [BR:kpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     KPN2242_06800
Amino acid related enzymes [BR:kpo01007]
 Aminotransferase (transaminase)
  Class II
   KPN2242_06800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase Aminotran_5 Cys_Met_Meta_PP AA_kinase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AEJ97278
Position
1443110..1444267
Genome map
AA seq 385 aa AA seqDB search
MSWQQRIDRALDERRAAEAFRRRLPVTHGAGRWLEREGERWLNFSSNDYLGLSQHPAIIA
AWQQGATRYGVGAGGSGHVSGYSEAHRALEEALADWLGYPRALLFISGFAANQALIAALV
EKDDRIVADRLSHASLLEAASLSPAQLRRFTHNDPQQLAQLLAKPLAGEQLAVTEGIFSM
DGDSAPLAAIHAATQAAGAVLLVDDAHGVGVVGDEGRGSCAAQAVRPELLVVTFGKAFGV
SGAAVLCDEAMADYLLQFARHLIYSTAMPPAQAVALSAALGIIRSDEGQQRRDILAARIR
QFREGMGEVSLGLTDSVSAIQPLIVGDNARALNLACRLRDAGCWATAIRPPTVPVGSARL
RLTLTAAHHTEDINRLLEVLHGHSE
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcagcagcgaatcgatcgggcgctggacgagcggcgggcggcggaagctttt
cgccgccgcctgccggtgacgcacggcgccgggcgctggctggagcgggaaggggagcgc
tggcttaacttctccagcaatgactatctgggcctgagtcagcatccggcgattatcgcc
gcctggcaacagggggccacgcgctatggcgtcggtgccggcggctcgggccacgtgagc
ggctatagcgaagcccaccgcgcgctggaagaggcgctcgccgactggctgggctatccg
cgcgcattgctgtttatctccggctttgccgcgaatcaggcgctgatcgccgccctggtg
gagaaagacgatcggattgtcgccgaccgtctgagccacgcctctctgctggaggcggcg
agcctcagcccggcgcagctgcggcgctttacccacaacgatccgcagcagctcgcgcaa
ctgctggctaagccgctggcgggcgaacagttggcggtcactgaaggcattttcagcatg
gacggcgacagcgcgccgctggcggccattcacgccgcgacgcaggccgcaggggcagtg
ttgctggtggatgacgcccacggtgttggcgtggtcggcgacgaaggacgcgggagctgc
gccgcgcaggcggtgcgccctgagctgctggtggttaccttcggcaaggccttcggcgtc
agcggcgcggcggtgctgtgcgacgaagcaatggccgattatctgctgcagtttgcccgt
catctgatctacagcaccgcgatgccgcccgcccaggcggtggcgttgagcgctgccctg
gggatcattcgcagcgatgaagggcagcagcgtcgcgacatcctggccgcccgcatccgt
cagttccgtgaggggatgggcgaggtgtcgctggggttgaccgactccgtcagcgcgatc
cagccgctgatcgtcggcgacaacgcccgggcgctgaacctggcctgccgtctacgcgac
gcgggctgctgggcaacggcgatccgtccaccgacggtgccggtcggcagcgcgcgtttg
cgcctgaccctgacagccgcccatcatactgaagacattaaccgtttactggaggtgctg
catggccacagtgaataa

DBGET integrated database retrieval system