KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_09060Help
Entry
KPN2242_09060     CDS       T01982                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00480  Glutathione metabolism
kpo00590  Arachidonic acid metabolism
kpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    KPN2242_09060
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KPN2242_09060
Enzymes [BR:kpo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     KPN2242_09060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEJ97726
Position
complement(1909001..1909483)
Genome map
AA seq 160 aa AA seqDB search
MTPFYQLTATRLRGQPLSMADYAGKVVLVVNTASHCGFTPQYAGLEALYKKYAAQGLVVL
GFPCNQFGKQEPGGADEIEQTCHVNYGVSFPMFEKVDVNGPAAHPLFRYLKQALPGVLGG
RIKWNFTKFLIGRDGTPLTRFAPFTTPEKMEASIVAALTR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacccctttttatcaattgacggctacccgcctgcgcggccagcccctctccatggct
gactatgctggcaaggtggttctggtggtgaatacggccagccattgtggcttcacaccg
caatacgctggcctggaagcgctctacaaaaagtacgcggctcaggggctggtagtgctt
ggtttcccgtgcaaccagtttggtaagcaggaacccggcggtgcggatgaaatcgagcag
acttgccacgttaactacggcgtgagcttcccgatgtttgagaaagtggacgtcaacggc
cccgccgcacacccgctgtttcgttatctgaaacaagcgttgcccggcgtgctcggcgga
cggatcaagtggaatttcaccaagttcctcatcggtcgcgacggcacacccctcacacgt
tttgcgccgttcacgacgccggagaaaatggaagcctccattgtcgcggccctcacgcgc
tga

DBGET integrated database retrieval system