KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_09410Help
Entry
KPN2242_09410     CDS       T01982                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01130  Biosynthesis of antibiotics
kpo01230  Biosynthesis of amino acids
Module
kpo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KPN2242_09410
Enzymes [BR:kpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KPN2242_09410
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     KPN2242_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEJ97794
Position
complement(1977714..1979072)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIVPTQRNFYDALAGTRTAFILECKKASPS
KGLIREDFDPAAIASIYKHYASAISVLCDEKYFQGSFDFLPIVSQVAPQPILCKDFTIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLSAVAHSLNMGVLTEVSNEEELERAIALKAKV
VGINNRDLRDMSIDLNRTRQLAARLGPDVTVISESGIHTYAEVRELSHFANGFLIGSALM
EQADLETAVKRVLLGENKVCGLTRPQDAQVAWESGAVYGGLIFVPTSPRAVNDAQAKAVI
AAAPLQYVGVFRNAPLEEVVARAQALGLAAVQLHGDEDQAYIDALRDALADNVRIWKALS
VGETFPARTLRHVDKYLLDNGQGGSGQRFDWSLLQGQDLRNVMLAGGLGADNCVEAAKSG
CAGLNFNSGVESQPGIKDASKLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcaaaaatcgttgccgacaaagcgatttgggtggaagcccgcaaa
caacaacaaccgttagccagttttcaaaatgagatcgttccgacgcagcgcaatttctat
gacgcactggccggcacccgcaccgcgtttattctcgagtgcaagaaggcctcgccgtcg
aaggggttgattcgcgaggatttcgatccggcagcgatcgccagcatctacaagcactac
gcctcggcgatctcggtactgtgtgatgagaaatatttccagggcagcttcgatttcctg
ccgatcgtcagccaggtcgcgccgcagccgatcctgtgtaaggacttcaccatcgaccct
taccagatctacctggcgcgctactatcaggccgacgcctgcctgctgatgctctcggtg
ctcgacgatgaacagtatcgtcagctctcggcggtggctcacagcctgaatatgggcgtg
ctcaccgaagtcagcaatgaagaggaactggagcgcgccatcgccctgaaggcgaaggtg
gtgggcattaacaaccgcgacctgcgcgatatgtcgattgaccttaaccgcacccgtcag
ctggcggcgcgtctcggcccggatgtcacggtgatcagcgaatccggcatccatacctat
gccgaagtgcgcgagctgagccacttcgccaacggcttcctgatcggctccgccctgatg
gagcaggcggatctggaaacggcggttaaacgcgtgctgctcggcgagaacaaagtgtgc
ggcctgacgcgcccgcaggatgcccaggtggcctgggagtccggcgccgtttacggtggg
ctgatcttcgtcccgacctcgccgcgagcggtgaatgacgcccaggccaaagcggtgatc
gccgctgcgccgctgcagtacgtcggcgtcttccgcaatgcgccgctggaggaggtggtc
gcccgcgcgcaggctctggggctggccgccgtgcagctgcacggtgatgaagaccaggcc
tatatcgacgcgctgcgcgacgccctcgcggacaacgtccgcatctggaaagcgctgagc
gtcggcgaaaccttcccggcccgtacgctccgccatgtcgacaagtacctgctcgacaac
ggccagggcggcagcggccagcgctttgactggagcctgctgcagggccaggatctgcgc
aacgtcatgctggcgggcggcctcggcgccgataactgtgtggaagcggccaaaagcggc
tgtgccggactcaatttcaattcaggcgtagagtcgcaacccgggattaaagacgccagc
aagctggcctccgtattccagacgctgcgcgcatattaa

DBGET integrated database retrieval system