KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_09750
Entry
KPN2242_09750     CDS       T01982                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpo02044]
    KPN2242_09750
Secretion system [BR:kpo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPN2242_09750
SSDB
Motif
Pfam: T6SS_VipA GerD
Other DBs
NCBI-ProteinID: AEJ97860
Position
2049854..2050345
AA seq 163 aa
MADTFQNEVPRARINLKLSLHTGGAQKKVELPLKLLTIGDFSHGKENRPLSEREKINVNK
NNFNSVLSEFSPEVNLSVPNTLAGNGEEENVRLRFTDIKDFEPEQVVRQIPQLRAMLAMR
NLLRDLKSNLLDNATFRKELEAILKDPALSQELRDEMSALAPK
NT seq 492 nt   +upstreamnt  +downstreamnt
atggctgatacgttccagaatgaagtccccagggcgcgcattaatctcaaattatctctt
cataccggcggcgcgcaaaagaaggtcgaactgccgctgaagctgcttaccattggcgat
tttagtcatgggaaggaaaaccggcctttatcggaaagagaaaaaatcaacgtcaataaa
aataattttaacagcgtactttcggaatttagcccggaagttaacctctcggtgccgaat
acgctggccggcaatggcgaagaggagaacgtcagactgcgttttaccgacatcaaagat
tttgaaccggagcaggttgtccggcaaattccgcaactccgcgccatgctggcgatgcgt
aatttattacgcgatctcaaatccaatctgctcgataacgccactttcagaaaagagctt
gaggcaatcctgaaagatccggcgctgtcccaggaattacgcgacgaaatgagtgcgctt
gccccgaaataa

DBGET integrated database retrieval system