KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_09755Help
Entry
KPN2242_09755     CDS       T01982                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpo02044]
    KPN2242_09755
Secretion system [BR:kpo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPN2242_09755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB PaaA_PaaC
Motif
Other DBs
NCBI-ProteinID: AEJ97861
Position
2050388..2051932
Genome map
AA seq 514 aa AA seqDB search
MSVTTENAPVQGQTTLQENSAGEGVYASLFEKINLTPASRLGDINDFLDDAALSEAPAAE
RLTAAMQVFMDRIRQSGQRVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQQVESLWR
GLKQLVDNTDYRQNVKTEILDVAKDDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIG
SVISAYEFDASPQDVALLRNISRVSAAAHMPFIGAVGPAFFLKETMEEVAAIKDIGNYFD
RAEYIRWKAFRETDDARYIGLVMPRVLGRLPYGPDTVPVRSFNYVEQVKGPDHEKYLWTS
AAFSFASNMVKSFVNNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPSEVMIPETRE
FEFASLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDASVVVEDIEDN
PGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttaccacagaaaacgcccctgttcaggggcaaaccacgctgcaggaaaacagc
gcgggcgagggcgtttacgcctcgctgtttgaaaaaattaatctcaccccggcgtctcgc
ctcggggatatcaacgactttctggacgatgccgcgctctccgaggcgccggcggcggag
cgtctcaccgcggcgatgcaggtgtttatggatcgcatccgtcagtccggccagcgggtg
gaaaagctcgacaaaacgctgatcgaccaccatatcgccgagctggatttccagataagc
cgtcagctggacgcggtgatgcaccatcaggagtttcagcaggtcgaatccctgtggcgc
ggcctcaaacagctggtggacaacaccgactatcggcagaacgtcaaaacggagatcctc
gacgtcgccaaagacgatctgcgccaggactttgaggacgcgccggagcttatccagagc
ggcctgtactggcacacctataccgcggagtatgacactcccggcggcgagccgatcggc
tcggtgatctcggcctatgagttcgacgccagcccgcaggatgtggcgctgctgcgcaat
atctcccgggtttctgcggccgcccatatgccgtttatcggcgccgtcggcccggccttc
ttcctgaaagagaccatggaagaggtggctgccattaaggatatcggcaactacttcgat
cgcgcggaatatattcgctggaaggcgtttcgtgaaaccgacgatgcccgctacatcggc
ctggtgatgccgcgcgtgctgggtcgtctgccgtacggcccggacaccgtgccggtgcgc
agcttcaactatgtcgagcaggtgaagggcccggaccacgaaaaatatctctggaccagc
gcggcgttctccttcgcttccaatatggtgaagagctttgttaacaacggctggtgcgtg
caaattcgcggtccgcaggcgggcggcgcggtgaaagatttgcctatccatctgtacgat
ctgggcaccggcaaccaggtgaagatcccttccgaggtgatgatcccggaaacgcgggag
tttgagttcgccagcctgggctttatcccgctgtcgtactacaaaaatcgcgattacgcc
tgcttcttctcggccaactccgcgcagaaaccggcgctgtacgataccgccgacgccacc
gccaacagccgtatcaacgcgcgtctgccttatatcttcctgctgtcgcgcatcgcgcac
tacctgaagatgatccagcgcgagaatatcggcaccaccaaggaccggcgtctgctggag
ctggagctgaacacctgggtgcggagcctggtgaccgaaatgaccgaccccggcgacgag
ctgcaggcctcccatccgctgcgcgatgccagcgtggtggtggaagatatcgaggataac
ccgggcttcttccgagtgaagctgtacgcggtgccgcacttccaggtcgaggggatggac
gtcaatctgtcgctggttagccagatgccaaaggcgaaggcgtag

DBGET integrated database retrieval system