KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_11720Help
Entry
KPN2242_11720     CDS       T01982                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K22602  oxamate amidohydrolase [EC:3.5.1.126]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00230  Purine metabolism
kpo01100  Metabolic pathways
kpo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KPN2242_11720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kpo01002]
    KPN2242_11720
Enzymes [BR:kpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.126  oxamate amidohydrolase
     KPN2242_11720
Peptidases and inhibitors [BR:kpo01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   KPN2242_11720
CD molecules [BR:kpo04090]
 Proteins
  KPN2242_11720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AEJ98244
Structure
PDB: 

Position
2449392..2450978
Genome map
AA seq 528 aa AA seqDB search
MHSSNVSTHGMAVAPHHLASQSALAILREGGSAIEAMVAAAAAIAVVYPHMNGLGGDGFW
LIVPPEGDPIAIDASGAAGSLATLEAYAGQRHIPHRGPQAALTVAGTVSGWDEALRISRD
LTGRALPVARLLADAIGYAEDGIPVTASQAHATASKLEELRHQPGFSETWLVAGEAPRPG
SRFRQPALAGTLRMLASDGLDSFYRGPLAERLAQGMATLGMPVTLGDLQAHRARRPGPLT
LQHQQGTLWNLAPPTQGLVSLAILGITDRLKMADADDAQTVHRIVEATKRAFALRDAHIT
DPRHLDVDVQQLLTPEALQPLADSIDDASASPWGGGKGPGDTVWMGVVDDSGLAVSFIQS
IYHEFGSGVVLPDTGIVWQNRGAAFSLDPQHLLALAPGKQPFHTLNPAAARLNDGRVMVY
GSMGGDGQPQTQAALFTRYILQGVPLQESISRPRWLLGRTWGQSSDSLKLEGRFAPACIA
RLRELGHDVEVLADFSEAMGHAGAIVRHPNGLLEGATDPRSNGAAAGY
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtagcaacgtttcgacccacggcatggcggtggccccccatcacctcgccagt
cagagcgcgctggcgatcctgcgcgagggcggcagcgccattgaagcgatggtggctgcc
gcggcggccatcgccgtcgtctatccccatatgaatggcctcggcggcgatggcttctgg
ctgatcgtgccgcctgagggagaccccatcgccattgacgccagcggggccgccggatcg
ctggcgaccctcgaggcctacgccggacagcggcatattccccaccggggaccgcaggcc
gcgctgaccgtcgccggcaccgtcagcggctgggacgaggcgctgcgtatttctcgggac
ttaaccggccgcgcgctgccggtggcccgcctgctggccgatgcgatcggctatgccgaa
gacggcattccggtcactgcctcgcaggcccacgccaccgccagcaaactggaagagctg
cgccatcagccgggcttcagcgaaacctggctggtcgcgggcgaggccccgcggcccggc
agccgcttccgccagcccgccctcgccggtaccctgcgcatgctggcaagcgacggtctc
gacagcttttatcgcgggccgctggccgagcgtctcgcgcagggtatggccacgctgggg
atgcctgtcaccctcggcgacctgcaggcccaccgcgccaggcgtccggggccgctgacg
ctccagcaccagcagggaacgctgtggaatcttgccccacccacgcaggggctggtgtcg
ctggcgatccttggcatcaccgaccgcctgaagatggccgatgccgacgacgcgcaaacg
gtgcaccgtatcgtcgaagccaccaagcgggcgtttgccctgcgcgatgcgcatatcacc
gatccgcgccatctggatgtggatgtacagcagttgctcaccccggaagccctgcagccg
ctggccgacagcatcgacgacgccagcgcttccccctggggcggcggcaaaggcccgggc
gataccgtctggatgggcgtcgtggatgacagcggactggcagtgtcatttattcagagt
atctatcacgagttcggcagcggcgtggtactcccggacaccgggatcgtctggcaaaac
cgcggggcggccttcagcctcgatccgcagcatctcctggcgctggcccctggcaaacag
ccattccacaccctcaaccctgccgccgcgcgcctgaacgatggccgggtgatggtctat
ggctcgatgggcggcgacggtcagccgcaaacgcaggcggcgctgtttacccgctatatc
ctgcagggggtgccgttgcaggagagcatctcccgtccgcgctggctgctgggccgcacc
tggggccagtcctccgactcactgaagctggagggacgctttgcccccgcctgtatcgct
cgcctgcgcgagctggggcatgacgtagaagtgctggctgatttcagcgaagcgatgggc
cacgccggcgccattgtccgtcatcccaacggcctgcttgaaggggcgaccgatccacgc
agcaacggcgccgccgccggatactaa

DBGET integrated database retrieval system