KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_13230Help
Entry
KPN2242_13230     CDS       T01982                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00071  Fatty acid degradation
kpo00072  Synthesis and degradation of ketone bodies
kpo00280  Valine, leucine and isoleucine degradation
kpo00310  Lysine degradation
kpo00362  Benzoate degradation
kpo00380  Tryptophan metabolism
kpo00620  Pyruvate metabolism
kpo00630  Glyoxylate and dicarboxylate metabolism
kpo00640  Propanoate metabolism
kpo00650  Butanoate metabolism
kpo00900  Terpenoid backbone biosynthesis
kpo01100  Metabolic pathways
kpo01110  Biosynthesis of secondary metabolites
kpo01120  Microbial metabolism in diverse environments
kpo01130  Biosynthesis of antibiotics
kpo01200  Carbon metabolism
kpo01212  Fatty acid metabolism
kpo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPN2242_13230
   00630 Glyoxylate and dicarboxylate metabolism
    KPN2242_13230
   00640 Propanoate metabolism
    KPN2242_13230
   00650 Butanoate metabolism
    KPN2242_13230
  Lipid metabolism
   00071 Fatty acid degradation
    KPN2242_13230
   00072 Synthesis and degradation of ketone bodies
    KPN2242_13230
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPN2242_13230
   00310 Lysine degradation
    KPN2242_13230
   00380 Tryptophan metabolism
    KPN2242_13230
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPN2242_13230
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPN2242_13230
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KPN2242_13230
Enzymes [BR:kpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPN2242_13230
Exosome [BR:kpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPN2242_13230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEJ98540
Position
2741804..2742985
Genome map
AA seq 393 aa AA seqDB search
MTDIAIVAAVRTPIGSFRGAFAPLSAVDLGAAVVRGLLERCQLPAAAVDELIFGQVLTAG
CGQNPARQTALRAGLPVDTPAVTVNLVCGSGLKAVQQAVQAIRCGDAGIVIAGGQESMSN
APYLMHGARDGLRFGHASLQDSMIQDGLWDAFNDYHMGITAENLADAFDISRERQDAFAA
SSQRKAAAAIAAGRFREEIVPVSVPQGKKPPRVVTDDEQPRPETSEQQLAQLRPAFRPAD
GSVTAGNASSLNDGAAAVLLMRVDKARELGLPVLARIVSSAVAGVDPSVMGIGPVSACRQ
ALQRAGWTLDEVDLIEANEAFAVQALAVGQLLEWDSEKVNVNGGAIALGHPIGASGCRII
VSLVHEMQRRGASKGLATLCVGGGQGIAMTLQR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgccattgttgctgcagtacgcaccccgataggcagctttcgcggcgcc
ttcgcccctctttccgccgtcgacctcggcgcggcggtggtgcgcggcctgcttgaacgc
tgccagctgcccgccgcagcggtcgacgaactaattttcggccaggtgcttaccgccggc
tgcgggcagaacccggcgcgccagaccgcgctgcgggccggcctgccggtcgacactccg
gcggtcaccgtcaatctggtgtgcggctccggactgaaagcggttcagcaggcggtgcag
gcgatccgctgcggcgacgccgggatcgttatcgccggcggccaggagagcatgagcaat
gctccctatctgatgcatggcgcccgcgacggcctgcgtttcggccacgccagcctgcag
gacagcatgatccaggacggcctgtgggacgccttcaacgactaccacatgggcattacc
gccgagaacctcgccgacgccttcgacatcagccgcgagcgccaggacgccttcgccgcc
agctcccagcgcaaagcggcggctgctatcgccgccgggcgctttcgcgaggagatcgtc
ccggtcagcgtcccgcagggcaaaaagccgccgcgagtcgtgactgacgatgagcaaccg
cgcccggagaccagcgagcagcagctggcccagctgcgcccggcgtttcgcccggctgac
ggcagcgtcaccgccgggaatgcctcgtcgctgaacgacggcgcagcggcggtcctgctg
atgcgtgtcgataaagcgcgcgagcttgggctgccggtgctggcgcgcattgtcagctca
gcggtcgccggggtcgacccgtcggtgatgggcatcggcccggtgagcgcctgccgccag
gcgctgcagcgcgccggctggacgctggacgaggtggaccttatcgaagccaacgaggct
tttgccgtccaggcgctggccgtcggccagctgcttgaatgggacagcgagaaggtcaac
gtcaacggcggcgccatcgccctgggccatcccatcggcgcctccggctgccggatcatc
gtcagcctggtgcatgagatgcagcgccggggcgccagcaaagggctggccaccctgtgc
gtcggcggcggccagggcatcgccatgacccttcaacgttaa

DBGET integrated database retrieval system