KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_14260
Entry
KPN2242_14260     CDS       T01982                                 

Definition
(GenBank) type VI secretion system protein ImpG
  KO
K11896  type VI secretion system protein ImpG
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpo02044]
    KPN2242_14260
Secretion system [BR:kpo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPN2242_14260
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AEJ98742
Position
complement(2962531..2964294)
AA seq 587 aa
MDDLTLRYFDAEMRYLREAAKAFAQAHPDRAAMLDLDKAGTPDPYVERLFEGFAFSVGRL
REKIDDDLPELTEGLVSMLWPHYLRTIPSLSIVALTPTLPAMKMAETVPAGFEISSRPLG
PKNTVCRYRTTRDLTLNPLAIDEAMMTAEPDGRSALRLRFACSELADWSQTDLRRLALYL
GEDAVTGSALHLWLTRRQAALYLRLPGQTERVSLDGYFSPGGFSEEDRLWPKGESAFSGY
QLLLEYFTFREKFMFVQLNGLENITLPAGISHFTLEVVFSEVWQSDLPVSASSLRLHCVP
VINLFTLEADPLTISGLESEYLLRPKRLQDGHTEIYSVDSVTGSGRTGEARYVPFTRFRH
QGGMMRRHAPERYYHTRVKRGVTGMHDTWLILGGQQWEADRELARETVSLRITGTNGQLP
RRALQSTLLDRCESISATPLTVRNLCRPTLPAYPPAEDRYHWRVMSHLGTRFLNMMSSAE
VLRGTLSLYNWREDELNNRRLDAILAVSHHRIQRFEQGFLLRGLDIEVTLDGSGFTGAGD
VHLFGDMLNRFFALYADMNQFNQLTLIVQPEGKCIRWKENHSLRLPG
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggacgatttaaccctgcgatattttgatgctgaaatgcgctacctgcgcgaggcggca
aaagcgttcgcgcaggctcaccccgatcgggcggcgatgctggatctcgataaagccggt
acgccggacccttacgttgagcgcctgtttgaaggctttgccttttccgtaggtcgcttg
cgcgaaaaaattgatgatgatctgccggagctgaccgaggggctggtcagcatgctgtgg
ccgcactatttgcgcactattccatcgctatcgatcgtggcgctgaccccaacgctgccg
gcgatgaagatggcggaaacggtgcccgccgggtttgagattagctcccgcccactgggg
ccgaaaaataccgtgtgccggtaccgaaccacccgcgatctgacgcttaacccgctggcg
atagatgaggcgatgatgacggcggagccggacgggcgttcggccctgcgactacgattc
gcctgtagcgagctggctgactggtcgcagaccgatctccgccgcctggcgctgtacctg
ggggaagacgccgttaccggcagcgccctccatctgtggctgacccgacgccaggccgcg
ctgtacctgcgtctgccgggtcagacagagcgggtaagcctcgacggctatttttccccg
gggggattcagcgaggaggatcgtttatggccgaagggggagagcgctttcagcggctat
cagctgctgctcgagtatttcacctttcgcgaaaaatttatgttcgtgcagctaaatggc
ctggaaaacatcaccctgccggcggggatatcgcatttcacgcttgaggtggtgttcagc
gaggtctggcaaagtgatttacccgtcagcgcaagcagcctgcgcctgcactgtgtgccg
gtgattaacctgtttacccttgaggccgatccgttgaccatcagcgggctggagagcgaa
tacctcctgcgtccgaagcgcctgcaggacgggcataccgaaatctattctgtcgacagc
gtgaccggctccgggcgcaccggggaggcgcgctatgtgcctttcacccgctttcgtcac
cagggcgggatgatgcgtcgccatgctcctgagcgctactaccacacccgcgtaaaacgg
ggcgtaaccggcatgcacgatacctggcttatcctcggcggacagcaatgggaggctgac
cgggagctggcgcgggaaacggtctccttgcgcatcaccggcactaacggccagctgccg
cgccgggcgctacagagcacgctgctggatcgctgtgagtcgatatcagccacgccgctt
accgtccgcaatctctgtaggcccacgctgccggcctatcccccggcggaagaccgctac
cactggcgggtcatgagccatctgggcacccgttttctcaacatgatgagcagcgccgag
gtgctgcgcggcacgctgtcgctctacaactggcgggaggatgagctcaataatcgccgt
ctggacgccattctggcggtcagccatcaccgaattcagcgtttcgagcagggcttcctg
ctgcgcgggctggatatcgaagtgacgctcgacggtagcggatttaccggtgcgggcgat
gtccacctgtttggcgacatgctcaaccgctttttcgcactgtatgccgatatgaatcag
ttcaaccagctgacgctcattgttcaacctgaagggaaatgtatccggtggaaagagaat
cacagtctgcgcctgcccggctga

DBGET integrated database retrieval system