KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_14265
Entry
KPN2242_14265     CDS       T01982                                 

Definition
(GenBank) ImcF-related family protein
  KO
K11891  type VI secretion system protein ImpL
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KPN2242_14265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpo02044]
    KPN2242_14265
Secretion system [BR:kpo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KPN2242_14265
SSDB
Motif
Pfam: IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: AEJ98743
Position
complement(2964428..2967394)
AA seq 988 aa
MLLWGGDPATPADADWLAALRKLRRRAVDGMVWVTSALDGMPATENSATSGLTPDAMDSV
SHALKLRYEALGWKLPLYVWSLHPRAGEQAGRVTQPVGCLLPANCSPQTLAGQLTGLIPQ
LTAQGIQQVCGQPQHNFLLALADQLTRKPETVTEPLSVLLNPYRPQPLAGVVFSAPSAEA
GRSISHHWGRDNRWDILPDRMTELPAGLRPRKQGVNWMRGMSVAAAALMLLWAASMTVSF
IANRHLVAIAQEQVRLASAEKQPLAVRLHALSALQKTLSQLEYRSQHGAPWYLRAGLSQN
DDLLAALFPHYGERAQPLLRDAAAHHLEEQLTAFVQLPPDSPLREKMTKTAYGQLKQYLM
LTRPEKMDAAWFATTLMQDWPQRSGIADAVWQGSGPSLLAFYAASLASHPQWRLPVDDGL
VSQVRTRLIRQLGQRNSESTLYQKMLAQVANQYADMRLADMTADTDASRLFSTDEVVPGM
FTRQAWEQAVQPAIEKVVAERRDEMDWVLSDTKQTAAQSTSPEALRARLAERYFADFSGA
WLDFLNSLRWQRAATLSDAIDQLTLMADVRQSPLVALMNTLSVQGRTGQTGEAIADSLVK
SARQLFNRDNSPVIDQRSGARGPLDATFGPVLALLDNRDGGTPTSRLSLQTFLTRVTQVR
LRLQQVTNATDPQAMTRLLAQTVFQGKAVDLTETRDYGSLVAAGLGQEWSGFGQTLFVRP
MEQAWQQVLTPAAESLNAQWRSAVVEDWNSAFGGRYPFKNTSSEVSLPLLAKYLNSETGR
IARFLQTRLNGVLHKEGSRWMADSINAQGLTFNPAFLQAMNTLSHLSDVAFANGEAGLHF
ALRPGTADGVMQTELVIDSQKLVYMNQMPVWRRFSWPADTEAPGASLSWVSTRAGTRQYG
DFPGAWGWIRLLDKAVVSAYPGTSSSWSLSWKAPDGLLLNYTLRTEAGEGPLALLALRNF
TLPETIFSVRASAERVPLTDDIPGEEGY
NT seq 2967 nt   +upstreamnt  +downstreamnt
gtgctgctgtggggtggcgatcctgcgactccggccgatgcagactggctggctgcgttg
cgtaaactgcgccgccgtgcggtggacggaatggtctgggtgacctcagcgctggacggt
atgccggcaacggaaaacagcgcaacctcaggtctcacgccagatgcaatggatagcgtg
tctcatgctttaaagcttcgctatgaggctctgggctggaagctgccgctgtacgtctgg
tccctgcatccgcgcgccggagaacaggccgggcgcgtcacccagccagtggggtgcctt
ttgcctgcgaattgttcaccgcagacgctcgccggacagcttaccgggctgataccgcag
ctgaccgcgcaaggcatacagcaggtctgcggtcagccacagcacaattttttactcgcg
ctggccgatcagttgacccgtaaaccggaaacggtgacggagccgttatcggtattgctt
aatccttaccgcccgcagccgctggccggagtggtgttcagcgcgccgtcggcggaggcc
ggccgcagtatcagccatcactggggccgggataaccgctgggatattctgccggacagg
atgacggaattacccgcaggtctacgtccgcgcaaacagggagtcaactggatgcgtggg
atgagcgtggccgccgccgccctgatgttactctgggccgcctcaatgacagtctctttt
atcgccaaccgccacctggtggcgatcgcacaggagcaggtgcggctggcctcagcggag
aaacagccgctggccgtacgcttgcatgcgctctccgcgttacagaaaacgctttctcaa
ctggaataccgctcgcagcacggcgcgccgtggtacctccgcgctggcctcagtcagaac
gatgacctgctggcggcgctgttcccgcactacggagagagggcgcagccgctgctgcgc
gatgcggcggcgcatcatctggaagagcagctcaccgccttcgtgcagctgccgccggac
agcccactgcgtgagaagatgacgaagaccgcttacggacaactgaaacaatatctgatg
ttgacccgcccggaaaaaatggacgccgcgtggttcgccactacgctaatgcaggactgg
ccgcagcgctcaggcatcgccgacgccgtctggcagggcagcggcccttcgctgctggca
ttttatgccgccagcctggcatcgcatccgcagtggcgtctgcctgtcgatgacggtctg
gtcagccaggtgcgcacacggttaattcgccaactgggccagcgcaacagtgagtccacg
ctttaccagaagatgctcgcgcaggtggcgaatcagtatgccgatatgcgcctggcggat
atgactgccgacaccgatgcttcgcgtctgttcagcactgatgaggtggtgccgggaatg
tttacccgtcaggcctgggagcaggccgtgcagccggccattgagaaagtggtcgcggaa
cgccgcgatgaaatggactgggtgctgagcgatacgaagcagactgccgcgcagtcgacg
tcgccggaagctctgcgagccaggctggcggagcgttatttcgctgatttcagcggcgcc
tggctggatttcctcaacagtctgcgctggcagcgcgcggcgaccctctccgatgctatc
gaccagctgaccctgatggccgatgtgcgccagtcgccgctggtggcgctgatgaacacc
ctgagcgtgcaggggcgaaccggccagaccggggaagccatcgccgattcgctggtcaaa
tcggccaggcagctgttcaaccgtgataactcgcccgtcatcgatcaacggtccggcgcg
cgcggtcctctggatgccaccttcgggcccgtactggcgctgctggacaatcgcgacggc
gggacacccaccagccgtcttagcctgcagaccttcctgacccgcgtcacccaggtgcgt
ctgcgcctgcagcaggtcaccaacgccaccgatccgcaggcgatgacccggttgcttgcg
cagacggtattccagggcaaggccgtggatttaaccgaaacgcgcgactacggcagcctg
gtggcggcggggctgggccaggagtggagtggatttgggcagacgctgtttgttcgcccg
atggaacaggcctggcagcaggtgctgaccccggcggcggaaagcctcaacgcccagtgg
cgcagcgcagtggtggaggactggaatagcgcttttggcggtcgctacccctttaaaaat
accagcagtgaagtctctctgccgctgctggcaaaatacctcaacagcgagaccgggcgc
atcgcccgctttctgcagacccggctgaacggcgtgctgcataaagagggaagccgctgg
atggcggacagtatcaatgctcaggggctgacgtttaacccggcctttctgcaggcgatg
aataccctgagccatctctccgacgtcgcgttcgccaacggcgaagcgggattgcatttt
gcgcttcgccccggcacggcggacggcgtgatgcagacggagctggtcatcgacagtcag
aaacttgtctatatgaaccagatgccggtctggcggcggttcagctggcccgctgacacc
gaagcgccgggcgccagtctgagctgggtcagtacccgggcgggcacccgccagtatggc
gatttcccgggcgcctgggggtggatccgtctgctggataaggcggtggtcagcgcttat
cccggaacgagcagcagctggagcctgagctggaaagcgccggatggtctgttgctgaac
tacacgctgcgtaccgaggcgggggaaggaccgctggcgctgctggcgctgcgaaacttt
acgctaccggagacgatattcagcgtgcgcgcgtctgctgaacgtgttccgctgaccgac
gatatacccggcgaagagggatactga

DBGET integrated database retrieval system