KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_16585Help
Entry
KPN2242_16585     CDS       T01982                                 

Definition
(GenBank) histidine/lysine/arginine/ornithine ABC transporter permease HisQ
  KO
K10016  histidine transport system permease protein
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kpo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    KPN2242_16585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpo02000]
    KPN2242_16585
Transporters [BR:kpo02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    KPN2242_16585
   Histidine transporter
    KPN2242_16585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 MFS_Mycoplasma
Motif
Other DBs
NCBI-ProteinID: AEJ99207
Position
complement(3482333..3483019)
Genome map
AA seq 228 aa AA seqDB search
MLYGFSQVILQGALVTLELALSSVVLAVLIGLAGAGAKLSSNRPLALVFEGYTTLIRGVP
DLVLMLLIFYGLQIALNSVTDALGMAQFDIDPMIAGIITLGFIYGAYFTETFRGAYLAVP
KGHIEAATAFGFSGGQTFRRILFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWQPFYFAIVCGLIYLVFTTVSNGVLLLLERRYTVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatgggttttcacaggttattttgcagggtgcgctcgtcaccctggagcttgcg
ctcagctcggtcgttctcgccgtcctgatagggctggcgggcgctggcgcaaagttatcg
agcaaccgtccactggcgctggtgtttgaaggctataccactctgatccgcggcgtgccc
gatctggtgctgatgctgctgattttctacggcctgcagattgcgctaaacagcgttacc
gacgcgctgggcatggcccagtttgatatcgatccgatgatcgccgggattattaccctc
ggctttatctatggcgcctattttacggaaaccttccgcggcgcctacctggcggtgccg
aaggggcatatcgaagcggctaccgcctttggctttagcggcgggcagacgttccggcgt
attctcttcccggcgatgatgcgctacgcgctgccggggataggcaacaactggcaggtt
atcctcaaggcgacggcgctggtctcgttgctggggctggaggatgtggtcaaagccacg
cagctggccgggaaaagcacctggcagccgttctacttcgccatcgtctgcggcctgatt
tatctggtttttaccaccgtttctaatggcgtactgctgctgctcgaacgccgctatacc
gttggcgtgaagagggctgacctgtga

DBGET integrated database retrieval system