KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_19260Help
Entry
KPN2242_19260     CDS       T01982                                 

Definition
(GenBank) glycoside hydrolase family protein 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Pathway
kpo00052  Galactose metabolism
kpo00500  Starch and sucrose metabolism
kpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KPN2242_19260
   00500 Starch and sucrose metabolism
    KPN2242_19260
Enzymes [BR:kpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KPN2242_19260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AEJ99735
Position
complement(4060549..4061982)
Genome map
AA seq 477 aa AA seqDB search
MTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDCWYMIVGAREGD
TGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAGFSN
RNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFSTPDGRRIVIGWLDMWESPL
PEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVDNCE
AMEVNLRWDCARSSAEQYGLRFGDGLRIYMDAQQQRLVLERHYPQYGLCGTRSVPLTAGA
DLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPHRELALFAWSGSAALTEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacaatctcccgggctgaacaggtactccagacacaacgccaggcgcttaat
ctgcgctggtatccgcactatcacctggcggcccgcgccgggtggatcaacgacccaaac
ggtctggtgtggtttgacggctggtaccatgccttttatcaacatcacccgtactccacc
cagtggggaccgatgcactgggggcacgcgcgcagtaaggatctggtgcactgggagcat
ttgccggtagccctggcgccggagggcccggaggataaagacggctgcttttccggctcg
gcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttccacggcgat
cctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgcgacgggatc
cactttgagcgccaggggatggtggtcgacaccccgccgggtatgcaccacttccgtgac
ccgaaggtctggcgtgaaggagactgctggtacatgatcgtcggcgcgcgcgaaggcgat
accggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggacgcgggggtg
ctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttcttcaccctc
aacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcggggttcagcaac
cgcaatctgttccagagcggctatctgatcggcgagtggcagccaggccagcgttttatt
cgccatggcgaattccgggagatggataacggccacgatttctatgccccgcaaagcttc
tccacccccgatggccggcggatcgtgattggctggctggatatgtgggaatcgccgctg
ccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctgagcctgagc
gcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgcggcgcctgg
ttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgacaactgcgag
gcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcagtatggtctg
cgctttggcgatggcctgcgcatctacatggatgcccaacagcagcgtctggtgctggag
cggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgaccgccggggcg
gatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtcaatgacggc
gaagcctgcctgagcagccgtatctatccgcaggctccccaccgtgaattagcgttattt
gcctggagcggctcggcggcattaaccgaagccggcgcctggcagctcgaataa

DBGET integrated database retrieval system