KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_0476Help
Entry
A79E_0476         CDS       T02213                                 

Definition
(GenBank) Oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Pathway
kpp00620  Pyruvate metabolism
kpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A79E_0476
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpp02000]
    A79E_0476
Enzymes [BR:kpp01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     A79E_0476
Transporters [BR:kpp02000]
 Other transporters
  Primary active transporters [TC:3]
   A79E_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AFQ63867
Position
498920..500692
Genome map
AA seq 590 aa AA seqDB search
MTVAITDVVLRDAHQSLFATRLRLDDMLPVAAQLDDVGYRSLECWGGATFDACIRFLGED
PWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMQAALQAVRRHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSVAIKDMSGILT
PHAAFELVSEIKKRYDVTLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTQYDTGLDIHRLEGIAAYFREVRKKYHAFEGQLKGTDSRILVAQVPGGML
TNLEGQLKQQSAAHRLDEVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGRTPAPVNAALQARVLDGADPVTCRPADLLKPELAQLEADVKRQAQEK
GITLAENAIDDVLTVALFPQPGLKFLENRHNPAAFEPVPQAEAAQPVAKAEKPAASGVYT
VEVEGKAFVVKVSDGGDVSQLTAAAPAPASAPAAAAPAGAGTPVTAPLAGTIWKVLASEG
QTVAAGEVLLILEAMKMETEIRAAQAGTVRGIAVKAGDAVAVGDTLMTLA
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgccattaccgatgtcgtcctgcgcgacgcccaccagtccctgttcgccacc
cgtctgcgtctcgacgatatgctgcccgttgccgctcagctggacgacgtcggctaccgc
tcgctggagtgctggggcggcgccacctttgacgcctgcatccgctttctcggcgaggac
ccgtgggtccgcctgcgcgagctgaaaaaggcgatgcccaagaccccgctgcagatgctg
ctccgcggtcagaacctgctcggctaccgccactacgccgacgacgtggtggagcgcttc
gtggagcgcgccgtcaaaaacggcatggacgtcttccgcgtcttcgatgccatgaacgac
ccgcgcaacatgcaggccgccctgcaggcggtccgccggcacggcgcccacgcccagggt
acgctttcgtacaccaccagcccggcccacaccctgcagacctggctcgacctcaccgaa
cagctgctggagaccggcgttgactccgtcgccatcaaggacatgtccggcattctgacg
ccgcatgccgcctttgagctggtcagcgaaatcaagaagcgctacgacgtcaccctgcac
ctgcactgccacgccaccaccggcatggcggagatggccctgctgaaggccattgaagcc
ggggtcgacggcgtcgacaccgccatctcctcgatgagcgccacctatggccacccggcc
accgaggcgctggtggccaccctcgccggcacgcaatatgacaccgggctggatatccac
aggctggagggcatcgccgcgtactttcgcgaggtgcgcaaaaaataccacgccttcgaa
ggccagctgaaaggcaccgacagccgcatcctggtcgcccaggtgccgggcgggatgctc
accaaccttgaaggccagctgaagcagcagagcgccgcccaccgtctggatgaggtgctg
gcggaaatcccccgcgtgcgcgaggacctcggcttcatcccgctggtgaccccgacctcg
cagattgtcggcacccaggcggtgctcaacgtcctgaccggcgagcgctacaaaaccatc
gcgaaggagaccgccggtatcctgaaaggcgagtacggccgcaccccggccccggtgaac
gccgccctgcaggcgcgggtgctcgacggcgccgacccggtgacctgccgcccggccgac
ctgctgaagccggagctggcgcagctggaagcggatgtgaaacgccaggcacaggagaag
ggcatcacgcttgccgaaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcag
cccggcctgaagttcctcgaaaaccgccacaacccggcggcctttgagccggtaccgcag
gcggaagccgcgcagccagtggcaaaagcagaaaaacctgccgcctccggcgtctacacc
gtggaggtggaaggcaaagcctttgtggtcaaagtcagcgacggcggtgacgtcagccag
ctgacggcggctgctcctgctcctgcctctgcacccgccgctgccgccccggccggcgcc
ggcaccccggtgaccgccccgctggcgggcactatctggaaggtgctggccagcgaaggc
cagacggtggccgcaggcgaggtgctgctgattctggaagccatgaagatggaaaccgaa
atccgcgccgcgcaggccggcaccgtgcgcggtatcgcggtgaaagccggcgacgcggtg
gcggtcggcgacaccctgatgactctggcgtaa

DBGET integrated database retrieval system