KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_1965
Entry
A79E_1965         CDS       T02213                                 

Definition
(GenBank) hypothetical protein ImpJ/VasE
  KO
K11893  type VI secretion system protein ImpJ
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpp02044]
    A79E_1965
Secretion system [BR:kpp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A79E_1965
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: AFQ65277
Position
2116458..2117828
AA seq 456 aa
MKAKGTGGAMKIFRPLWRDGAFLVPQQFQQQARWDAHVADTVSRMALAHPWGVLRAEFDA
SALTLSRLNATRLIVRFADGTLIDTELADILPPVRDVSDVMQDSVEVLLALPLLSASGGN
LDDGQESARPRRWRAEQVTVQELAGHERSELAVLRHALTLRLSTEENAAFLTCPVARLVR
DAQGQWIVDPEFIPPLLSLAASPTLVSELGELLHRLQARRRRLMAMRRESNARMADFAVA
DVSLFWLLNALNSAEPVLSELHQDPSRHPELLYRELARLAGSLLTFSLEHHLEAIPRYRH
ASPEQVFPPLFALLDTLLEVSLPSRVIAIALEQGADREIWRGRLHDARLREGAEFLICRC
ALHYPPHQLQSRFPQLCKAGSHDDVAEVVNIALSGIAIKPLSHVPAAIPLRLENQYFALD
LSTDAARAMLEAGNCTFYTPESLGDVKLELFAVLRS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaaagcgaaaggcacaggaggtgcaatgaagattttccgcccattatggcgcgacggg
gcttttctggtcccgcagcagtttcagcaacaggcccgctgggacgcgcacgtcgccgat
acggtctcccgcatggctctcgcccacccgtggggggtattgcgcgcggagtttgacgcg
agcgcgctcaccctttcccggctcaacgctacccggctgatcgtgcgtttcgccgacgga
acgctgattgacaccgagctggcggatattttgccaccggtccgcgatgtatcggacgtg
atgcaggacagcgtggaggttctgctcgctctgccgctgctcagcgccagcggcggcaat
cttgatgacggccaggagagcgcccgcccgcgccgctggcgcgccgagcaggtgaccgtc
caggagctggccggccatgaacgcagcgagctggccgttctgcggcacgcgctaacgctg
cgtctctccaccgaggaaaatgcagcctttctcacctgcccggtagcgcgtctggtgcgc
gacgcccaggggcagtggatcgttgacccggaattcatcccgccgctgctgtcgctggcg
gcaagcccgacgctggtcagcgagctgggcgagctgttacatcgcctgcaggcccgacgc
agacgcctgatggccatgcgtcgtgaaagcaatgcgcggatggctgattttgccgtggcg
gatgtttccctgttctggctgctcaacgcgctgaacagcgctgaaccggtgctcagcgag
ctgcatcaggacccttcgcgccatccggagctgctctatcgcgaactggccaggctggcc
ggcagtctgctgactttctcccttgaacatcatctggaagcaatcccccgctaccggcat
gcctcgccagagcaggtattcccgccgctgtttgccctgctggatacgctgctcgaagtc
agcctgccctcaagggtgatcgccatcgctctggagcagggcgccgaccgggagatctgg
cggggcaggctgcacgatgcgcggctgcgcgagggggcggagtttttaatctgtcggtgc
gctcttcactacccccctcaccagctacagagccgctttccgcagctctgtaaggcgggt
agccatgatgatgtcgccgaggtcgtcaatattgccctcagcggcatcgcgatcaaaccg
ctgagccatgtgccggcggccattccgctacgtctggaaaaccaatatttcgctctggat
ctctccaccgacgccgcccgcgcgatgctggaggccggcaactgcaccttctataccccg
gaatcgcttggcgacgtgaaacttgaactctttgcggtactgcgctcatga

DBGET integrated database retrieval system