KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_1966
Entry
A79E_1966         CDS       T02213                                 

Definition
(GenBank) putative transmembrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Pathway
kpp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A79E_1966
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpp02044]
    A79E_1966
Secretion system [BR:kpp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A79E_1966
SSDB
Motif
Pfam: DotU SfLAP
Other DBs
NCBI-ProteinID: AFQ65278
Position
2117825..2118478
AA seq 217 aa
MNTSESDLINKTFYPGWLMVSQLRCGQPVTDGEALYRQACRWVTEAREALTAGGVSEASA
EQMLYAYCALLDESVLNRASQDDGYRRWRKDPLQARFFSTLNAGEELWERIRQLLREPTA
DAAVLTCFFRTLQLGFVGQYRAEDDERREDVAQALGARVPPFSLTQEAPVVVRASRLRSG
RRMYWCGWAAGIVALAALWLTCSAMLSQMVAQIAGQG
NT seq 654 nt   +upstreamnt  +downstreamnt
atgaatacctctgaaagcgatctgatcaacaaaactttttacccgggctggctgatggtc
agccagttacgctgcggccagccggtgacggatggcgaggcgctctatcgccaggcctgt
cgatgggtgaccgaggcgcgcgaggcgctgacggcggggggagtcagtgaagccagcgct
gagcagatgctctatgcctactgcgcgctgctggatgagagcgtcctcaaccgcgccagt
caggatgatggctaccgcaggtggcgcaaggatccgctgcaggcgcgctttttcagcact
ctcaacgccggggaagagctctgggaacggatccgccagctgctgcgagagcccacggcg
gatgcggcagtgctgacctgcttctttcgtactttacagctgggatttgtcggacagtac
cgcgccgaggatgacgaacggcgtgaggacgtggcgcaagcgcttggcgcgcgggtcccg
ccgttcagcctgacccaggaggcgccggtggtggttcgtgcctcccggctgcgcagcgga
cggcggatgtactggtgcggctgggcggctggcattgtggcgctggcggcgctgtggttg
acctgctccgccatgctgtcacagatggtggcgcagatagcagggcagggataa

DBGET integrated database retrieval system