KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_1968
Entry
A79E_1968         CDS       T02213                                 

Definition
(GenBank) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Pathway
kpp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A79E_1968
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpp02044]
    A79E_1968
Secretion system [BR:kpp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A79E_1968
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1 Cthe_2159
Other DBs
NCBI-ProteinID: AFQ65280
Position
2120638..2123124
AA seq 828 aa
MDTSSIITGTTLNRYQLDIPSCTASLDVEEFSGAEKLSELYYYTITFTSAEKNIDAAQLL
SKPAMLTMGGGALQQLADCKRVHGVVTAFRRISSSEDQSKYQITLEPFLSLLDKQFRSHR
FFVNKSVPEVVEQVLQEHHLHDWEYEFYLKQHYPRREQINQYQESDLAFIQRLLAEVGIF
YFFTLQEEAQSEVVHFADAQRALMFDKTLPVNSPSGMSDSGAESIWGLSITHNVVEANVT
TRDYNPRDAQSVLQSATADMTRGNGEGITYGEVYHYKLRHRERGDKIDPQTETANFYARL
DHERFLAHQTLITAISTAAWLAPAQVLTVTDSLPSTLPAPVQDPLLITGTGFTASRREAL
RVSLLAVPYSETLCWRPPLLPRPKVTGTMTARVTSAKANDIYAWQDASGLYRVKFDPDRD
EKGQGQESMPVRLAKPYGGDVYGFHFPLIQGTEVAIAFHEGDPDRPYIAHALHDSRHVDP
VTEKNSTRNVIRTPTNNKLRMEDKRGEEHIKLSTEYGGKTQLNLGHNVNAQRELRGEGAE
LRTDKWVSIRGGAGVFISADKQPSAGDRMLAMEEAIAQLENALGIAKSLASAAESAQALP
SDTGNQQTLNDALKELAQPGIVLNAPQGVSISSPQAVRLSSGSASVGIVSQQNTDISALK
RFTVAAGEAVSLLARKAGMKLFAAKGKIEIQAQDDALEATAKKDITVTSVEGRVEITAAE
ELVVNCAGAYIRLSGGNIELGCPGNILLKSANVQKMGAADYDANKPELPVGFSEFFTAKD
EESGEILPFTRYRITTGEGKVFEGRTDAEGKTVAVYTALPDALHIELL
NT seq 2487 nt   +upstreamnt  +downstreamnt
atggatacctcttcaataattaccggcaccacccttaaccgttaccagctggatattcct
tcatgtaccgcatcgctggatgtggaagaattcagtggggcagaaaaactgagtgaactt
tattattacactattacgtttaccagcgcagagaaaaatattgatgccgcacagctcctg
agcaaacccgccatgctgacgatgggcggcggcgcactgcagcagctggcggactgcaaa
cgcgtccatggcgtggtgactgccttccggcgtatcagcagttcagaagatcagtcgaaa
tatcagataaccctcgaacccttcctctccttactggataaacagtttcgcagccaccgt
tttttcgtgaataaatcggtgccggaggtggtggagcaggtattgcaggaacatcacctg
catgactgggagtatgagttttatctcaagcaacactatccacggcgcgagcaaattaat
cagtatcaggagagcgacctggcatttatccagcgcctgctggcagaggtggggatattt
tatttcttcaccctgcaggaagaggcgcagagcgaagtggttcacttcgccgacgcgcag
cgggcgctgatgttcgataagacacttcctgtaaacagcccgtccgggatgagcgacagc
ggtgcggaatcgatatggggtctgagcatcacccacaacgtcgtagaggcgaacgttact
acccgggattataacccccgcgatgcgcagagcgttctccagtcggcaacagcggatatg
acccggggaaatggtgaaggcatcacttacggtgaggtataccactataagcttcgccac
cgggagcgtggcgataaaatcgacccgcagacggagaccgccaacttctatgcccgcctc
gaccatgagcgttttctggctcaccagacgcttattaccgcgatcagtactgcagcctgg
ctggcgccggcccaggtgctgaccgttaccgacagcctgccgtcgaccctgcctgcgccc
gtacaggatccgctgttaatcaccggcaccggttttaccgccagccgccgggaggcgctg
cgggtgtccctgctggcggtgccctacagcgaaacattgtgctggcgtccgccgctgctg
ccgcgcccgaaggtgactggcaccatgacggcgcgggtgaccagcgcgaaagcgaatgat
atctacgcctggcaggatgcgtccggcctgtaccgggtgaaatttgaccctgacagagat
gagaaagggcaggggcaggaaagcatgccggtgcgtctcgccaaaccctacggcggcgac
gtgtacggctttcacttcccgctgatccagggcacggaggtggcgattgctttccacgaa
ggcgaccctgaccggccgtatattgcgcatgcgctgcacgactcgcggcatgtcgatcct
gtgacggagaaaaacagcacccgcaatgtgattcgtactccgaccaacaataagctgcga
atggaggataagcgcggcgaggagcatatcaagctcagcaccgagtacggcggcaagacg
cagttgaacctggggcataacgtgaatgcgcagagggagttgcggggcgagggtgcggaa
ctgcgtacggataaatgggtgagcatccggggcggtgcgggagtgtttatcagtgcggat
aaacagccttcggcaggcgacaggatgctggcaatggaggaggcgattgcgcagcttgaa
aatgccctgggtattgcgaaaagcctggcgtcggcagcggaatcggctcaggccctgcca
tcggataccggcaaccagcagacgctgaacgatgcgctgaaagagctggcgcagccgggg
atagtgctgaatgcgccgcagggcgtgagcatcagcagtccgcaggcggtacggttgtct
tcgggtagcgccagcgtggggattgtgtcacagcagaatacggacattagtgcgctgaaa
cgttttacggtggcggcgggagaagccgtcagcctgctggcgcgaaaggcggggatgaag
ctgtttgcggcgaagggaaagattgaaatccaggcgcaggatgatgcgctggaggcgacg
gcgaaaaaggatatcaccgtgaccagcgtggaagggcgagtggaaatcacggcggcggag
gaactggtggtgaattgtgcgggagcgtatatcaggctaagtggtggcaatatcgagctg
ggctgccctgggaatattctgctgaaatcggccaatgtgcagaaaatgggcgcagctgat
tatgatgcaaacaaacctgagcttcccgtcggtttcagtgagttttttactgcaaaagat
gaagagtccggggagattttaccttttacccggtacaggataacaaccggtgaaggtaaa
gtatttgaaggcaggaccgatgcggaaggtaaaactgttgcagtttatactgccctgcct
gatgccctgcatatagaattactttaa

DBGET integrated database retrieval system