KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_1983
Entry
A79E_1983         CDS       T02213                                 

Definition
(GenBank) putative membrane protein
  KO
K11891  type VI secretion system protein ImpL
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Pathway
kpp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A79E_1983
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpp02044]
    A79E_1983
Secretion system [BR:kpp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A79E_1983
SSDB
Motif
Pfam: IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: AFQ65294
Position
2132167..2135577
AA seq 1136 aa
MNIPGNGLGRFGLAGLTLAGMAAIWWGITRYGGMLNINTRGEQVLAFVQVCLALVFVFYL
PAMSRRVKESLYRRQSQQDSVLPGEEGRVALTPPHHITVGEIRQTLRYQYGRAWSRKVRI
LLIIGSVRDVEQLTPKLTQELWQEDQGTLLLWGGDPGAAVDNAWFTALRKLRYRPADGMV
WVTSGFDGVLTTMNRTKPRLTPDEMDSVSHSLKLRFEALGWKLPLYVWSLYEGGNEKNGR
ITQPVGCLLPAGCTPQIVAEQFTALASLLIEQGIQQICGQPQHNFLLALADQLTRKPETV
TEPLSVLLNPYRPQPLAGVVFSEASVEAGRSVRHHWGRDNRWETIPDSVLWLPAGLRPRK
QGVNWMRGMSVAAAALMLLWAASMTVSFIANRHLVAIAQEQVQQASAGKQPLAVRLHALS
ALQKTLSQLEYRSQHGAPWYLRAGLSQNDDLLAALFPRYGERAQPLLRDAAAHHLEEQLT
AFVQLPPDSPLREKMTKTAYGQLKQYLMLTRPEKMDAAWFATTLMQDWPQRSGIADAVWQ
GSGPSLLAFYAASLASHPQWRLPVDDGLVSQVRTRLIRQMGQRNSESTLYQKMLAQVANQ
YADMRLADMTADTDASRLFSTDEVVPGMFTRQAWEQAVQPAIEKVVAERRDEMDWVLSDT
KQTAAQSTLPEALRARLAERYFADFSGAWLDFLNSLRWQRAATLSDAIDQLTLMADVRQS
PLVALMNTLRVQGRTGQTGEAIADSLVKSARQLFNRDNPPVIDQRSGARGPLDATFGPVL
ALLDNRDGGTPTSRLSLQTFLTRVTQVRLRLQQVTNATDPQAMTRLLAQTVFQGKAVDLT
ETRDYGSLVAAGLGQEWSGFGQTLFVRPMEQAWQQVLTPAAESLNAQWRSAVVEDWNSAF
GGRYPFKNTSSEVSLPLLAKYLDSETGRIARFLQTRLNGVLHKEGSRWMADSINAQGLTF
NPAFLEAMNTLSHLSDVAFANGEAGLHFALRPGTADGVMQTELVIDSQKLVYMNQMPVWR
RFSWPADTEAPGASLSWVSTRAGTRQYGDFPGAWGWIRLLDKAVVSAYPGTSSSWSLSWK
APDGLLLNYTLRTEAGEGPLALLALRNFTLPETIFSVRASAERVPLTDDIPGEEGY
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgaatataccgggtaatggcctgggccggtttggcctggccgggcttacgttggccggg
atggctgcaatatggtgggggatcacccgctatggcggcatgctgaatatcaatacgcgg
ggcgagcaggtactggcgtttgtccaggtctgtctggcgttggtatttgttttttacctt
cctgcaatgtcccgccgtgtgaaggagagtttatatcgccggcagtcgcagcaggacagc
gtcttacccggcgaagaagggcgcgtggcgctgacacctccccatcatattacggtgggg
gaaattcgccagactctacgctatcagtatggacgcgcctggtcccgcaaagtccgtatt
ctgctgataattggctcagtcagagacgtagaacaactgaccccaaagctcacgcaggaa
ctctggcaggaagatcagggtacattattgctgtggggtggagaccctggggcagcggta
gataacgcctggttcacagcgctgcgtaaactgcgttatcgcccggctgatggtatggtg
tgggtaacatcgggctttgacggcgttttgacaacgatgaacagaacgaagcccaggctc
acgccagatgaaatggacagtgtgtctcactctctaaagctacgcttcgaagctcttggc
tggaaactacccctatacgtctggtcgctgtatgaggggggcaacgaaaaaaatggacgt
atcactcagcctgtgggctgcctgttacctgcaggttgtacgccgcaaatagttgccgaa
cagttcactgccctggcgtcgttactgatagagcagggcatccagcagatatgcgggcaa
ccacagcacaattttttactcgcgctggccgatcagttgacccgtaaaccggaaacggtg
acggagccgttatcggtattgcttaatccttaccgcccgcagccgctggccggggtggta
tttagtgaggcgtcagtagaggctggtcgcagtgtccgtcatcactggggacgggataac
cgctgggaaacgataccagactcagtgctgtggttgccagccggtctacgtccgcgcaaa
cagggagtcaactggatgcgtgggatgagcgtggccgccgccgccctgatgttactctgg
gccgcctcaatgacagtctcttttatcgccaaccgccacctggtggcgatcgcacaggag
caggtgcagcaggcctcggcgggaaaacagccgctggccgtacgcctgcatgcgctctcc
gcgttacagaaaacgctttctcaactggaataccgctcgcagcacggagcgccgtggtac
ctccgcgcaggcctcagtcagaacgatgacctgctggcggcgctgttcccgcgctacgga
gagagggcgcagccgctgctgcgcgatgcggcggcgcatcatctggaagagcagctcacc
gctttcgtgcagctgccgccggacagcccactgcgtgagaagatgacgaagaccgcttac
ggacaactgaaacaatatctgatgttgacccgcccggaaaaaatggacgccgcgtggttc
gccactacgctaatgcaggactggccgcagcgctcaggcatcgccgacgccgtctggcag
ggcagcggcccttcgctgctggcattttatgccgccagtctggcgtcgcatccgcagtgg
cgtctgcctgtcgatgacggtctggtcagccaggtgcgcacacggttaattcgacagatg
ggccagcgcaacagtgagtccacgctttaccagaagatgctcgcgcaggtggcgaatcag
tatgccgatatgcgcctggcggatatgactgccgacaccgatgcttcgcgtctgttcagc
actgatgaggtggtgccgggaatgtttacccgtcaggcctgggagcaggccgtgcagccg
gccattgagaaagtggtcgcggaacgccgcgatgaaatggactgggtgctgagtgatacg
aagcagactgccgcgcagtcgacgttgccggaagctctgcgagccaggctggcggagcgt
tatttcgctgattttagcggcgcctggctggatttcctcaacagtctgcgctggcagcgc
gcggcaaccctctccgatgctatcgaccagctgaccctgatggccgatgtgcgccagtcg
ccgctggtggcgctgatgaacaccctgcgcgtgcaggggcgaaccggccagaccggggaa
gccatcgccgattcgctggtcaaatcggccaggcagctgttcaaccgtgacaacccgccc
gtcatcgatcaacggtccggcgcgcgcggtcctctggatgccaccttcgggcccgtactg
gcgctgctggacaatcgcgacggcgggacacccaccagccgtcttagcctgcagaccttc
ctgacccgcgtcacccaggtgcgtctgcgcctgcagcaggtcaccaacgccaccgatccg
caggcgatgacccggttgcttgcgcagacggtattccagggcaaggccgtggatttaacc
gaaacgcgcgactacggcagcctggtggcggcggggctgggccaggagtggagtggattt
gggcaaacgctgtttgttcgcccaatggaacaggcctggcagcaggtgctgaccccggcg
gcggaaagcctcaacgcccagtggcgcagcgcggtggtggaggactggaatagcgctttt
ggcggtcgctacccctttaaaaataccagcagtgaagtctctctgccgctgctggcaaaa
tacctcgacagcgagaccgggcgcatcgcccgctttctgcagacccggctgaacggcgtg
ctgcataaagaggggagccgctggatggcggacagtatcaatgctcaggggctgacgttt
aacccggcctttctggaggcgatgaataccctgagccatctctccgacgtcgcgttcgcc
aacggcgaagcgggattgcattttgcgcttcgccccggcacggcggacggcgtgatgcag
acggagctggtcatcgacagtcagaaacttgtctatatgaaccagatgccggtctggcgg
cggttcagctggcccgctgacaccgaagcgccgggcgccagtctgagctgggtcagtacc
cgggcgggcacccgccagtatggcgatttcccgggcgcctgggggtggatccgtctgctg
gataaggcggtggtcagcgcttatcccggaacgagcagcagctggagcctgagctggaaa
gcgccggatggtctgttgctgaactacacgctgcgtaccgaggcgggggaaggaccgctg
gcgctgctggcgctgcgaaactttacgctaccggagacgatattcagcgtgcgcgcgtct
gctgaacgtgttccgctgaccgacgatatacccggcgaagagggatactga

DBGET integrated database retrieval system