KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_1986
Entry
A79E_1986         CDS       T02213                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Pathway
kpp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A79E_1986
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpp02044]
    A79E_1986
Secretion system [BR:kpp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A79E_1986
SSDB
Motif
Pfam: T6SS-SciN Lyx_isomer DUF1363
Other DBs
NCBI-ProteinID: AFQ65297
Position
2138549..2139037
AA seq 162 aa
MVTVLTGCGLTQTVKDGAVSVTQSIFYPQVKTLHLDLRAREGVNNNAKGASLATVVRIYQ
LKDRQAFDNTDYPSLFAGDGQALQADRVAEKDVRLRPGESVTVDMPMETSAQFVAVAAMF
IDPDLTQNSWRLVLTRDELDPARPRIIEASQNQLTLHPFKEK
NT seq 489 nt   +upstreamnt  +downstreamnt
atggttaccgtcttaaccggctgcggactgacgcagaccgtgaaagacggtgccgtttcc
gtgacccagtccattttttacccccaggtgaaaaccctgcatctggatcttcgcgcccgg
gaaggcgtgaataacaacgccaaaggcgcctccctggcgacggtggtgcgtatttatcag
ctgaaggaccggcaagcgttcgacaatactgactacccgtcgctgtttgccggcgatggc
caggcgctgcaggcggaccgggtggcggaaaaagatgttcgcctgcgtccgggcgaatcg
gtgaccgtcgatatgcccatggaaaccagcgcgcagtttgtggcggtggcggccatgttt
atcgatccagacctgacgcaaaacagctggcggctggtactcacccgggacgaacttgat
ccggcgaggccgcgcattatcgaagccagccaaaatcaactgacgctgcacccgtttaag
gagaagtga

DBGET integrated database retrieval system