KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_1988
Entry
A79E_1988         CDS       T02213                                 

Definition
(GenBank) hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpp02044]
    A79E_1988
Secretion system [BR:kpp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A79E_1988
SSDB
Motif
Pfam: VasL ImpA_N DHR10 Lant_dehydr_C
Other DBs
NCBI-ProteinID: AFQ65299
Position
2139503..2140918
AA seq 471 aa
MMTTHHDRHYKAGGDPRTLADFMALRAEMNKLSHPARPDINWPYAEQLARGLLEHHGADL
QTVAWYTLARARLGGVAGINEGLTLMESLLVRQGKNLWPQALPARTEIFRTLSKRLRQVI
RTLNLTPEDVESLEQAERSLQSFDAVLQRLEIAPENQLSDLRALLHSTATRFESLDPAPA
LPTAPPVAVSDAELPGTLVSEEDAAKVEPVPDLKRRPKAEPLAPPSPAKRPAPVAASTPA
AAPRWKPFIAGMVTMLAVTGIAVGGWLALRQSDLPPISVTQNAGPIPGLPATTPPGPVDL
PQTQRQLGELARLAPDWAVSYGDQLVHQALIRWPDQAQPLAQQWRQQLSAGALPAENLTG
WSEGMQQLQRLADQLNALDEQKGKYLTVSELKTAVFAITQSFNRAVPLEEQLRQLAALPV
DQPWPAARGSLAELHLQQLIVEYALLKRKQPASPTAALPATGEPSVSEAVK
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgatgacaacacaccacgaccgtcactataaagccggtggcgacccgcgcacgctggct
gattttatggccctgcgtgcggaaatgaacaagctcagccacccggcgcggccggatatt
aactggccgtatgccgagcagcttgcccgcgggctgttggagcatcacggcgcggacctg
cagactgtcgcctggtataccctggcccgcgcccggctgggcggggtggcagggatcaat
gaggggctgacgctgatggagtcgctgctggttcgtcaggggaaaaacctgtggccacag
gcgctcccggcccggacagagatcttccgcaccctgagcaagcggctgcggcaggtgatc
cgtaccctgaatcttaccccagaggatgttgagtcgcttgagcaggctgaacgttcgctg
caaagcttcgacgcagtactccagcgccttgagatcgctcctgaaaaccagctgagcgac
ctgcgggcgctactgcacagcacggcaactcgcttcgagagcctcgaccctgcgccagcg
cttcccaccgcgccgccggtggcggtgtctgacgcggaacttcccggcactctggtcagc
gaagaggatgcggcgaaggttgagccagtgccagacctaaaacgtagaccaaaggctgag
ccgctggctccgccttcacctgcaaagcggcccgcgccggtggcggcgtctactcccgca
gccgcgccgcgctggaagccgtttatcgccgggatggttaccatgctggcggtaacgggt
atcgccgtcggcggatggctggcgctgcgtcagtccgacttgccgcccatttcggtcacc
caaaatgccggaccgataccgggcctgccggcgacaacgcccccggggccggttgatctg
ccacagacgcagcgccagcttggcgagcttgcccgcctggcgccggactgggcggtcagc
tacggcgaccagctggtccaccaggccctgatccgctggccggatcaggcgcaaccgctg
gcgcagcagtggcggcagcagctgagtgctggcgcattgcccgcggaaaaccttaccggc
tggtcggagggcatgcagcaactgcagcggctcgccgaccagctcaatgccctcgacgag
cagaaggggaagtacctgacggtgagcgaactgaaaaccgcagtatttgccatcacgcag
tcgtttaaccgcgctgttccgctggaggagcagctgcgccagctggccgcgcttcccgtt
gatcaaccctggccagccgcgcggggaagcctcgcggagctgcatctgcaacagctgata
gtggagtatgccctgctgaagcgaaaacagccggcgtcgccgaccgctgcgctccccgca
accggtgagccctcggtgagtgaggcggtgaaataa

DBGET integrated database retrieval system