KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_2197Help
Entry
A79E_2197         CDS       T02213                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00071  Fatty acid degradation
kpp00072  Synthesis and degradation of ketone bodies
kpp00280  Valine, leucine and isoleucine degradation
kpp00310  Lysine degradation
kpp00362  Benzoate degradation
kpp00380  Tryptophan metabolism
kpp00620  Pyruvate metabolism
kpp00630  Glyoxylate and dicarboxylate metabolism
kpp00640  Propanoate metabolism
kpp00650  Butanoate metabolism
kpp00900  Terpenoid backbone biosynthesis
kpp01100  Metabolic pathways
kpp01110  Biosynthesis of secondary metabolites
kpp01120  Microbial metabolism in diverse environments
kpp01130  Biosynthesis of antibiotics
kpp01200  Carbon metabolism
kpp01212  Fatty acid metabolism
kpp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A79E_2197
   00630 Glyoxylate and dicarboxylate metabolism
    A79E_2197
   00640 Propanoate metabolism
    A79E_2197
   00650 Butanoate metabolism
    A79E_2197
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A79E_2197
   00072 Synthesis and degradation of ketone bodies
    A79E_2197
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A79E_2197
   00310 Lysine degradation
    A79E_2197
   00380 Tryptophan metabolism
    A79E_2197
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A79E_2197
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A79E_2197
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A79E_2197
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpp04147]
    A79E_2197
Enzymes [BR:kpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A79E_2197
Exosome [BR:kpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A79E_2197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFQ65503
Position
complement(2357416..2358597)
Genome map
AA seq 393 aa AA seqDB search
MTDIAIVAAVRTPIGSFRGAFAPLSAVDLGAAVVRGLLERCQLPAAAVDELIFGQVLTAG
CGQNPARQTALRAGLPVDTPAVTVNLVCGSGLKAVQQAVQAIRCGDAGIVIAGGQESMSN
APYLMHGARDGLRFGHASLQDSMIQDGLWDAFNDYHMGITAENLADAFDISRERQDAFAA
SSQRKAAAAIAAGRFREELVPVSVPQGKKPPRVVTDDEQPRPETSEQQLAQLRPAFRPAD
GSVTAGNASSLNDGAAAVLLMRVDKARELGLPVLARIVSSAVAGVDPSVMGIGPVSACRQ
ALQRAGWTLDEVDLIEANEAFAVQALAVGQLLEWDSEKVNVNGGAIALGHPIGASGCRIL
VSLVHEMQRRGASKGLATLCVGGGQGIAMTLQR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgccattgttgctgccgtacgcaccccgataggcagctttcgcggcgcc
ttcgcccctctttccgccgtcgacctcggcgcggcggtggtgcgcggcctgcttgaacgc
tgccagctgcccgccgcagcggtcgacgaactaattttcggccaggtgctcaccgccggc
tgcgggcagaacccggcgcgccagaccgcgctgcgggccggcctgccggtcgacactccg
gcggtcaccgtcaatctggtgtgcggctccgggctgaaagcggttcagcaggcggtgcag
gcgatccgctgcggcgacgccgggatcgttatcgccggcggccaggagagcatgagcaat
gctccctatctgatgcatggcgcccgcgacggcctgcgtttcggccacgccagcctgcag
gacagcatgatccaggacggcctgtgggacgcctttaacgactaccacatgggcattacc
gccgagaacctcgccgacgccttcgacatcagccgcgagcgccaggacgccttcgccgcc
agctcccagcgcaaagcagcggccgctatcgccgccgggcgctttcgcgaggagctcgtt
ccggtcagcgtcccgcagggcaaaaagccgccgcgagtcgtgactgacgatgagcaaccc
cgcccggagaccagcgagcagcagttggcccagctgcgcccggcgtttcgcccggctgac
ggcagcgtcaccgccgggaatgcttcgtcgctgaacgacggcgcagcggcggtcctgctg
atgcgtgtcgataaagcgcgcgagcttgggctgccggtgctggcgcgcattgtcagctca
gcggtcgccggggtcgacccgtcggtgatgggcatcggcccggtgagcgcctgccgccag
gcgctgcagcgcgccggctggacgctggacgaggtggaccttatcgaagccaacgaggct
tttgccgtccaggcgctggccgtcggccagctgcttgaatgggacagcgagaaggtcaac
gtcaacggcggcgccatcgccctgggccatcccatcggcgcctccggctgccggatcctc
gtcagcctggtgcatgagatgcagcgccggggcgccagcaaagggctggccaccctgtgc
gtcggcggcggccagggcatcgccatgacccttcaacgttaa

DBGET integrated database retrieval system