KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_2819
Entry
A79E_2819         CDS       T02213                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Pathway
kpp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A79E_2819
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpp02044]
    A79E_2819
Secretion system [BR:kpp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A79E_2819
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AFQ66112
Position
complement(2973735..2974277)
AA seq 180 aa
MLRISLTKTACLLPLLALCLSGCGLTQRVSEGTKSAFNAVFYKKINTLHLDFTAREALNT
DARENHSLSEPVVVRIYQLKDRQTFDRLVYQQLLEEGDILLAADLLASRDVVIGPGGDAS
LNMPLEAEATFVAVVGLFRHPDTQRNTWKQVLAREELDPDKPRIFTAEHNQLRLRPEAAK
NT seq 543 nt   +upstreamnt  +downstreamnt
gtgttacgtataagtttgactaaaaccgcctgtctgctgcccctgcttgcgctttgcctg
agcggatgcggactcacccagcgcgtctcggagggaacaaagtctgccttcaacgccgtt
ttttataagaaaattaatacgctgcatctggactttaccgcgcgcgaagcgctcaacacc
gatgccagagagaatcactcgctctctgaaccggtggtggtgcgcatctatcagcttaaa
gatcgccagacctttgaccggctggtttaccagcagctgctggaggagggggatattctg
ctcgccgccgatctcctcgccagtcgcgatgtggtgatcggtcccggaggggacgccagt
ctgaatatgccgctggaagcggaggcgacgttcgtggcggttgtcggcctgttccgccat
ccggacacacaaagaaatacctggaagcaggtgctggcgcgtgaggaattggatccggac
aagccgcgcattttcaccgccgaacacaaccagctacggctcaggcctgaagcggcgaag
taa

DBGET integrated database retrieval system