KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_2820
Entry
A79E_2820         CDS       T02213                                 

Definition
(GenBank) hypothetical protein ImpH/VasB
  KO
K11895  type VI secretion system protein ImpH
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpp02044]
    A79E_2820
Secretion system [BR:kpp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A79E_2820
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AFQ66113
Position
complement(2974255..2975340)
AA seq 361 aa
MGREAQPPHSRLTPRLEADLPRINFYRFCQLLEKRRPGQPLMGGTSHPADDPVRFYPHPG
MGFPASELKAVEYDEADDSRPPVIRTTFMGLYGVDSPLPTAYLDDIAQHREGHEALQGLL
DIFSHRIMTQFYRIWRKYSWPATFEPGGTDRLSQSLLGLAGLGIPGTTQHIASPASRFLA
LTGVLRQPGKTQQGIQALVTLLAPETTVRVSPYSLRPVAISQPLGFYGDDDFFLDGNTPL
GDEAMDASSQLLVALTTDNPAEAQGWKPDGPLFRDFLILLRVYLGWRFRANITLTAPTRL
LAVPPLGDEPFWLGMNGVLGVGEGESEGDIPQTFTTELGTYTGLQPATFLQGNRRVTYKF
D
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgggaagagaagcacagccgccgcattcccggctgaccccgcgactggaggccgacctg
ccgcggatcaatttttaccgcttctgccagcttctggaaaaacggcgtcccggccaaccg
ctgatggggggaaccagccatccggctgacgatccggtgcgtttttacccgcatccggga
atgggatttcccgccagcgaactgaaagccgtggaatacgatgaggccgatgacagcagg
ccgccggtcattcgcaccacctttatggggttgtacggtgtcgattcgccgctcccgacg
gcatatctcgatgatatcgcccagcacagggaagggcatgaagcgctgcagggcttactg
gatatcttcagccaccggatcatgacgcagttttaccgcatctggcggaaatactcctgg
cccgccacctttgagcccggcggcaccgatcgtctctcgcagtcgctactgggcctggcg
gggctgggcatccccggcacgacgcagcatatcgcctcgccggcgtcgcgctttctggcg
ctaaccggcgtgctgcgtcagccgggcaaaacccagcaggggatccaggcgctggtcacc
ctgctggccccggagaccaccgtcagggtgagcccgtacagcctgcgtccggtggcgatc
agccagccgctggggttttacggcgatgacgacttcttcctggacggcaatacgccgctg
ggtgacgaagcgatggatgccagcagccagctcctcgtcgcccttaccaccgacaatccc
gcggaggcgcagggctggaagcctgacggcccgctgtttcgggactttctcatcctgctg
cgggtatacctcggctggcgattccgggccaacatcaccctgaccgcgccgacccgactg
ctggctgtcccgccgctgggggacgagccgttctggctcggtatgaacggcgtgctgggc
gtgggtgagggcgagagtgagggcgatattcctcagacctttaccaccgagctgggtacc
tatacgggcctgcagcctgccacctttctacaaggaaaccgacgtgttacgtataagttt
gactaa

DBGET integrated database retrieval system