KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_2832
Entry
A79E_2832         CDS       T02213                                 

Definition
(GenBank) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Pathway
kpp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A79E_2832
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpp02044]
    A79E_2832
Secretion system [BR:kpp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A79E_2832
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1 HAP1_N
Other DBs
NCBI-ProteinID: AFQ66125
Position
complement(2991421..2994111)
AA seq 896 aa
MKSLLFSHNHHLLSVKGCEAGLDVLAFEGDEALSQPFRYRIEFTSADHAISKEMMLMKAA
SLTLQAPVAQGFGINVQQPVRVIQGVVTGFERLSTSRDETHYALTLQPRLALLNRSHQNA
IYQDQSVPQIVEKILRERHGLRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGI
WFRFTADTRLHIDVAEFCDSQQGYEKGLTLPSVPPSGQQSAGVDAVWEMACRHRVVEQQV
STRDYNYREATADMNAQVDVTRGETTTFGEAYHWGDNYLTAGNVHDRHPAPESGAFYARL
RHERYLNGQTRMQATTSCPTLCPGQVLKVTGGEEVAGEFADGVLVTAMHSHARRDADFAV
EFAGIPDSPDVGYRPEPGARPVMAGTLPARVTSTRENDTYGHIDKHGRYRVNMLFDRARW
ETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVT
IRNDKRNVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAEKQPRGEGFELR
TDSWGAIRAQKGIFISADGQVQAQGQVLDMEPAVSNLAEAREQMMSISGDAQKATANPAD
LQAQITLLEQQLTDLKKSVLLVSAPEGIALTSGEHLQVSAGHNLIATAGKNADVSVVKNL
FIGVGSALSVFVRKLGIRLIANQGPVQMQAQNDLMALLARKEISIVSTEDEIKIIAKKKL
TLNGGGSYIRLDANAIESATAGEYRTKAGYYGRQESASEKVKMPVFPVMEPGEHSLRFAF
PGADSVSQSMNWLINQPYSISDSAGKILSTGTVDTSGRFPKIVLPESDTLNLIIGRETWS
KEELSVSSTEDDSMEDFEDEAPDADLHLSEMGFEDDRTSALTESMISTLLSLTKDS
NT seq 2691 nt   +upstreamnt  +downstreamnt
gtgaaatcgttgttgttcagccataaccaccacctgctttcggtgaagggatgtgaagcc
gggcttgatgtgctggccttcgagggcgatgaagccctgagccagccgttccgctaccgt
attgaattcaccagcgcagaccatgccatcagcaaagagatgatgctgatgaaggcagcc
tccctgacgctgcaggcgccggtggctcagggcttcggcatcaatgttcagcaacccgtg
cgggtgatccagggcgtggtgacggggtttgaacggctcagtacctccagggatgaaacg
cactacgcgctgacgcttcagccgcgcctggcgctgcttaaccgctcgcaccagaacgcc
atttaccaggaccagtccgttccgcagattgtggaaaaaatcctccgcgagcgccacggc
ctgcgcggtcaggattttctgttctcgctgacaaaaacgtatccgcgacgcgagcaggtg
atgcagtacggcgaggatgacctgcgctttatcacccggctgctgggtgaggtggggatc
tggtttcggtttaccgccgacacgcggctgcacatcgacgtcgctgagttctgcgacagt
cagcagggctatgagaaggggctgacgttgccttcggtcccgccgtcagggcagcagtcg
gccggggtggacgcggtgtgggagatggcatgtcgccaccgcgtcgtggagcagcaggtc
agtacccgcgactacaactaccgcgaggcgacggcggacatgaacgcgcaggtggatgtc
acccgcggggagaccactacctttggtgaggcttaccactggggagataactacctgacc
gcggggaatgtccatgaccgccatccggcgccggagtccggggcgttttacgcccggctt
cggcatgagcgttatcttaacggccagacccggatgcaggccaccaccagctgcccgacg
ctctgcccgggacaggtgctgaaggtcaccggcggagaggaggtggccggggagtttgct
gatggcgtgctcgtcacggcgatgcacagccacgcccggcgcgatgccgactttgcggtg
gagtttgccggcataccggacagcccggacgtcggctaccggcctgagcccggcgcgcgt
ccggtgatggccgggacgctgccggcccgcgtgaccagcacccgggaaaacgacacctac
gggcatatcgacaaacacggacgctaccgggtgaatatgctgtttgaccgggcgcgctgg
gaaaccggtttcgagagcctgtgggtccgccagtcgcggccgtatgccggagacacctac
ggcctgcacctgccgctgctggccgggacggaggtggcgattggctttgaggatggtaac
cctgaccggccgtatatcgcgggcgtgctgcacgactcggcgcacggcgaccacgtcacc
atccgcaatgacaaacgtaacgtcctgcgcaccccggccaacaacaaaatccgcctcgac
gatgagcgcggaaaagagcatatcaaggtctcgacggagtacggcggtaagagccagctg
aacctcggccatctcgtggatgctgaaaagcagccgcgcggcgaaggctttgagctgaga
accgacagctggggcgctatccgggcacagaaagggatatttatcagcgcggacggacag
gtgcaggctcaggggcaggtgctggatatggagccggcggtcagcaatctggccgaagcc
cgggagcagatgatgtccatctccggtgacgcgcagaaggcgaccgcgaacccggccgat
ctccaggcgcaaattaccctgctggagcagcagctgacagacctcaaaaaatcggtactg
ctggtcagcgcgccggaggggatagcgctgaccagcggggagcacctgcaggtctcagcc
gggcataacctgattgccacagccggaaagaatgcagacgtcagcgtggtgaaaaatctg
ttcatcggggtgggcagtgcgctgagcgtgtttgtgcgaaagcttgggatcaggctgata
gcgaatcagggaccggtacagatgcaggcgcagaatgacctgatggcgctgcttgcccgg
aaggaaatcagcattgtcagcacggaggatgaaatcaaaatcatcgcgaagaagaagctg
accctgaatggtggggggagttatatcagacttgatgcaaatgcgattgaatctgctact
gcaggcgaatatcgcacgaaagcaggatattacgggcgtcaggaaagcgcttctgaaaaa
gtcaaaatgcctgtatttcctgtaatggagcctggagagcacagtttacgttttgctttt
ccaggtgcggatagtgtcagccagagtatgaactggctgataaatcagccgtacagtatt
tctgatagcgctggaaaaattctgtctaccggaacagtagacacttcaggtcgttttccc
aaaatagtacttcctgaaagcgatacattaaatttaatcattggccgagaaacttggagt
aaagaggagctttctgtctcatcaactgaagacgacagtatggaggattttgaggatgaa
gcacctgatgccgatcttcatttaagtgaaatgggttttgaagatgatagaacatcagca
ttgactgaatcaatgatttcaactttattaagtttaacaaaggatagttga

DBGET integrated database retrieval system