KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_2833
Entry
A79E_2833         CDS       T02213                                 

Definition
(GenBank) ClpB protein
  KO
K11907  type VI secretion system protein VasG
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Pathway
kpp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A79E_2833
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpp02044]
    A79E_2833
Secretion system [BR:kpp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A79E_2833
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_16 AAA_22 AAA_25 NACHT ATPase_2 Sigma54_activat AAA_7 Clp_N AAA_24 IstB_IS21 AAA_23 Zeta_toxin ResIII TIP49 SRP54 T2SSE AAA_6
Other DBs
NCBI-ProteinID: AFQ66126
Position
complement(2994113..2996767)
AA seq 884 aa
MENPASLLRRLNPCCARAMEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEW
DMDALWQDLLSWLDKQPRSVRHRPQLSHHTLRLMQEAWLIASLSGEAQIRSVHLLMALVE
KQNLIQCDGLWPLLTLGQRQLERLRPLLDAQSDERPPAQQEAALAQPHGGDVEFVGRPAG
SELNADGLNPALQNALDKFTLDVTAKARDGLIDPVFGRDTEIRQMVDILSRRRKNNPILV
GEPGVGKTALVEGLALCIAEGNVPDALKPVSVRTLDLGLLQAGAGVKGEFEQRLKNIIEA
VQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQYFER
DAALERRFQMVKVDEPDDDTACLMLRGLKSRYADHHGVHITDDAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTASARLRMSLDTVPEPLTRMKAQLTALAMEKQALLEDIALGNSARGDRLA
AIEQEEIRLILALDTLETQYGQELQLTEALLACRRDISRQAEISDLQTALIAVQQGNPLL
GLDVDVRTVATVIADWTGVPLSSLMKEEQTELLSLEESLGKRVVGQEAALSAIARRLRAA
KTGLTPENGPQGVFLLVGPSGTGKTETALALADALFGGEKALITINLSEYQEPHTVSQLK
GSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVMNLFYQVFDRGVMRDGEGREI
DFRNTVILMTANLGSDLLMQLLDEQPEASESDLHELLRPVLRGHFQPALLARFQTVIYRP
LPAGALRAIVGMKLGQVSQRLACHYGITTTLSESLFDALTEACLLPDTGARNVDSLLNQQ
ILPALSQQLLSHMAAGQKPRQVTLGYHEEEGVVMAFDEGTISDE
NT seq 2655 nt   +upstreamnt  +downstreamnt
atggaaaatccagccagcctgttacgccgtcttaatccctgctgtgcccgcgcaatggag
ggggcggcctccctgtgccagacccgggcgcatgccgagatcctgcccgagcactggctg
ctcaagctgctggaacagggggaaggcgatctgacggtgctggcgcggcgctatgaatgg
gatatggatgcgctgtggcaggatctgctgagctggctggataaacagccgcgctcggta
cgtcatcgtccccagctctctcaccataccctgaggctgatgcaggaggcctggctgatt
gcctctctcagcggcgaagcgcagatccgcagtgttcacctgctgatggcgctggttgaa
aaacagaatctgatccagtgcgatggcctgtggccgctgttaacgctgggccagcgtcag
ctggaacgcctgcgccccttgctggatgcccagtccgacgaacgtccgccagcgcagcag
gaagcggcgcttgcgcagccccatggcggggacgtggaatttgtggggcgtcccgcgggc
agcgaactgaatgcggatgggctcaacccggcgctgcagaacgcgctggacaaattcact
ctcgacgtcaccgccaaagccagagacggcctgattgacccggtgttcggacgtgacacg
gaaatccgccagatggtggatattctctcccgtcgacgtaaaaacaacccgatcctcgtc
ggtgagccgggcgtgggcaagaccgctctggtggaaggcctggcgctgtgcattgccgaa
ggcaacgtccccgacgcgctgaagccggtgtcggtgcgcaccctcgacctcggtctgctg
caggccggcgccggggtcaaaggcgagttcgagcagcggctgaaaaatatcattgaggcg
gtacagcagtcgccttcgccggtgctgctgtttatcgacgaggcgcacacgatcatcggc
gcgggtaatcaggcgggcggcgcggatgccgccaacctgttgaagccggctctggcccgg
ggcgagctgcggaccatcgccgccaccacctggagtgaatacaagcagtacttcgagcgc
gacgccgcgctggagcgccgctttcagatggtcaaggtggatgagccggacgacgacacc
gcctgcctgatgctgcgcggcctgaagtcccgctatgccgaccaccacggcgtgcatatc
acggatgatgcggtgcgcgccgccgtgacgctgtcacgacgctatctcaccggtcgccag
ctgccggacaaggcagtggatttactcgacaccgcttccgcccgcctgcgtatgagtttg
gataccgtgcctgagccgctgacccgcatgaaggcgcagctcaccgcgctggcgatggag
aagcaggcgctgctggaagatattgcgctgggcaacagcgcccgcggcgatcggctggcg
gccattgagcaggaggagatccgccttattctggcgctggatacccttgaaactcagtat
ggtcaggagctgcagctgacggaagcgctgctcgcctgccgccgcgatatctcccgccag
gcggaaattagcgatctacaaaccgcgcttatcgccgtccagcagggcaatccgctgctc
gggctggacgtcgacgtccgcaccgtggcgacggtgattgccgactggaccggcgtgccg
ctctcctcgctaatgaaagaagagcagacggagctgctgagtctggaagagagtctcggc
aaacgggtggttggccaggaggcggccctgagcgctattgcccggcgcctgcgcgccgcg
aaaaccggcctgacgccggagaacggtccgcaaggggtgttcctgctggtcgggccgagc
ggcaccggcaaaacggaaacggcgctcgccctggccgatgcgctgttcggcggcgagaaa
gcgctgatcaccatcaatctctccgagtaccaggagccgcacaccgtcagccagctgaag
ggttctccgcccggctacgtcggctacggccagggcgggatcctgaccgaggcggtgcgc
aaacgcccctacagcgtggtgctgctcgatgaggtggaaaaggcccatcgcgatgtgatg
aacctgttctaccaggtcttcgaccggggggtaatgcgcgacggcgaggggcgtgaaatc
gactttcgcaacaccgtgatcctgatgaccgccaacctcggaagcgacctcctgatgcag
ttgctggatgaacagccggaggccagcgaatcagacctgcacgagctgctgcgcccggtg
ctgcgcggccacttccagccggcgctgctggcccgcttccagacggtgatttaccgtccg
ctgccggcgggagcgctgcgcgccattgtcggcatgaagctcgggcaggtaagtcagcgt
ctggcttgccattacggaatcaccaccaccctcagcgagagcctgttcgacgcgctgacc
gaggcctgcctgctgccggataccggcgcccgtaacgtcgacagtctgctcaatcagcag
atcctgccggcactgagtcagcagctattgagccatatggcggcggggcagaaaccgcgc
caggtgacgctggggtatcacgaagaggaaggcgtcgtgatggcgtttgacgaggggaca
atatccgatgagtag

DBGET integrated database retrieval system