KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_2835
Entry
A79E_2835         CDS       T02213                                 

Definition
(GenBank) Putative cytoplasmic protein USSDB7A
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Pathway
kpp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A79E_2835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpp02044]
    A79E_2835
Secretion system [BR:kpp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A79E_2835
SSDB
Motif
Pfam: T6SS_HCP Inhibitor_I24
Other DBs
NCBI-ProteinID: AFQ66128
Position
complement(2997031..2997522)
AA seq 163 aa
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKVVKVNPLMHD
IKNPAYEKHNHLEQIELRYEKITWTYKDGNIIHSDSWNERATA
NT seq 492 nt   +upstreamnt  +downstreamnt
atggcaattcctgtttatctttggctgaaagacgacggcggcgcggacattaaagggtct
gtcgacgttcaggatcgtgaaggcagtatcgaagtggtggcccaggagcataacctgtac
atcccgaccgataacaacaccggcaaactgaccggcacgcgtattcatacgccgttcctg
ttcaccaaggagatcgactcctccagcccctacctgtacaaggcggtgaccaccggccag
accctgaaatccgccgagttcaagtggtaccgaatcaacgatgccggccaggaagtggag
tatttcaataccaaacttgagaacgtcaaggtggtgaaagtgaatcccctgatgcacgac
atcaaaaaccccgcctacgagaagcacaaccatctggaacagattgagctgcgctacgag
aagatcacctggacctataaagacggcaacatcattcactccgatagctggaacgaacgc
gccaccgcgtaa

DBGET integrated database retrieval system