KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1): A79E_2838Help
Entry
A79E_2838         CDS       T02213                                 

Definition
(GenBank) hypothetical protein ImpJ/VasE
  KO
K11893  type VI secretion system protein ImpJ
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084 (serotype K1)
Brite
KEGG Orthology (KO) [BR:kpp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpp02044]
    A79E_2838
Secretion system [BR:kpp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A79E_2838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: AFQ66131
Position
complement(2999916..3001259)
Genome map
AA seq 447 aa AA seqDB search
MMKTERPLWGRGIMVSPQHFQQQAAYAAWTAEVIARMGLNHPWGVVEATFEPEMLKLGRL
QAHRLQVRFQDGTMIDTDNADALPSALSLDGASGEAVIVLALPLMQANGGNCLKPEEVAE
RPVRFRQRWRDVRNQFGDDTRQIAVIQPELILRFAHQDNSDYLTCPLVRLQRDSQGAWLI
DETFLPPLLQIQGSRWLATQLEQLLVQLRARLTRLMAMRRESNERMADFAVADVSLFWLL
NALNSAEPVLGYFLRYRQSPPERLYPELARLAGSLLTFSLTHQANAVPIYQHDQLNAVFP
PLFDLLSDLLEASLPSRVVAIALEHDVRLHFWQARLHDARLREGADYYLSVRSSVPVAQL
QEQFPRQCKVGSPDHVKAIVNSSRTGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEM
LQSGTCMFYVPGMLGEPELELFAVLRT
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaacggaacgtccgttgtggggccggggcattatggtgtcgcctcagcatttt
caacagcaggctgcgtatgcagcctggactgcggaagtgattgcccggatgggtcttaac
cacccctggggagtggttgaggcgaccttcgaaccagagatgctcaaactgggccgcctg
caggctcacaggctgcaggtccggttccaggatggcacgatgattgatacggacaatgcc
gatgcgctgccgtccgcgctgtcgctggacggcgcgtccggcgaggcggtgatcgtgctg
gcgctgcccctgatgcaggcgaatggcggcaactgtctgaagccggaggaggtggccgaa
aggccggtgcgcttccgccagcgctggcgcgatgtccgcaaccagtttggggatgatacc
cggcagattgccgtcatacagccggagctgatcctccgcttcgcccaccaggacaacagc
gattacctgacctgtccgcttgttcgcctgcagcgggactcgcagggggcctggcttatc
gacgagacgtttctcccgccgctgctgcagatccagggcagccgctggctggcgacgcag
cttgaacagctgctcgtccagctccgggctcgtctgacgcgcctgatggccatgcgtcgc
gaaagcaatgaacggatggctgattttgccgtggctgatgtctctctgttctggttgctg
aatgcgctgaacagcgccgagccggtgctggggtactttctgcgttaccggcaaagcccg
ccggaacgcctctacccggagctggcgcgcctggctggtagcctgctgaccttttcgctc
acccatcaggcgaatgccgtcccgatctatcagcatgaccagctgaacgcggtttttccg
ccgctgtttgatttactgagcgacctgctggaggcgagcctgccatcgcgggtggtggcg
attgcgctggagcatgatgtccggctgcacttctggcaggcgcgtctgcacgatgcccgg
ctgcgggaaggggctgattactacctgtcggttcgttcgtcggtaccggtcgcccaactg
caggagcagtttccgcgccagtgcaaagtgggcagtccggatcatgtcaaagccatcgtc
aactcctcgcggacaggggtgcccctcacgccattgcgtcatgtgccggcggcgatcccg
ctgcgtctggaaaatcagtatttcagcctcgatgtgtcccaccctctggcaacggaaatg
ctgcagagcggcacctgtatgttttacgtcccggggatgctcggtgagcctgaacttgaa
ctttttgcggtactacgaacgtga

DBGET integrated database retrieval system