KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4287Help
Entry
A79E_4287         CDS       T02213                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00260  Glycine, serine and threonine metabolism
kpp00750  Vitamin B6 metabolism
kpp01100  Metabolic pathways
kpp01110  Biosynthesis of secondary metabolites
kpp01120  Microbial metabolism in diverse environments
kpp01230  Biosynthesis of amino acids
Module
kpp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A79E_4287
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A79E_4287
Enzymes [BR:kpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     A79E_4287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFQ67513
Position
complement(4550950..4552230)
Genome map
AA seq 426 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKHQGLFFPHDLPEFSLTEIDDMLAQDFVTRSAKILS
AFIGDEIPQDVLQQRVRAAFAFPAPVSKVQEDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKATLGLNSANSINISRLLAQICYYFEAAAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRYLQGGEWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLSELGYAAVDDETTKAAMRELKAIGYISEPHAAIAWRA
LRDQLQPGEYGLFLGTAHPAKFKESVEEILQETLPLPKELADRADLPLLSHNLPADFAAL
RKLMMG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttaaaagatcataacgagcaggtcagctttgcgcaggccgtcacc
cagggacttggcaagcatcagggcctgttctttccgcacgatctgccggaattcagcctg
actgaaatcgacgacatgctggcgcaggactttgtcacccgtagcgccaaaattctatcc
gcctttatcggcgatgagatcccgcaggatgtcctgcagcagcgggtgcgcgcggcgttt
gcgtttccggcgccggtaagcaaggttcaggaagatgtcggctgtctggagctgttccat
ggccctacgctggcgttcaaggatttcggcggccgctttatggcgcagatgctgacccac
atcgcaggcgataagccggtcaccatcctcaccgcgacctctggcgacaccggggcggcg
gtggcgcatgctttctacggcctgccgaacgtcaaggtagtgatcctctatccgcgcggc
aagatcagtccgctgcaggagaagctgttctgtaccctcggcggcaatattgaaaccgtg
gcgattgatggcgactttgatgcctgccaggcgctggtgaagcaggcgtttgacgatgaa
gagctgaaggcgacgctgggtctcaactcggctaactccatcaacatcagccgcctgctg
gcgcagatctgttactacttcgaagcggcggcgcagctgccgcaggaagcccgcaatcag
ctggtgatttccgtgccgagcggcaacttcggcgatctgaccgccggtctgctggctaag
tcgctggggctgccgatcaagcgctttatcgccgccaccaacgccaacgacaccgttccg
cgctatctgcagggcggcgagtgggcgccaaaagccacccaggcgacgctgtccaacgcc
atggacgtcagccagccgaacaactggccgcgcgttgaagagctgttccgccgtaaaatc
tggcgtctcagcgagctgggctatgccgcggtcgatgatgagaccaccaaagcagcgatg
cgcgagctgaaggccatcggctacatctctgaaccgcatgcggcgattgcctggcgcgcg
ctgcgcgatcagctgcagccgggagagtacggcctgttcctcggcaccgcccatccggcg
aagttcaaagagagcgtggaggagatcctgcaggagactctgccgctgccgaaggagctg
gccgaccgcgccgacctgccgctgctgtctcacaacctgccggcggatttcgccgcgctg
cgtaagctgatgatgggctaa

DBGET integrated database retrieval system