KEGG   Klebsiella pneumoniae subsp. pneumoniae 1084: A79E_4710Help
Entry
A79E_4710         CDS       T02213                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
kpp  Klebsiella pneumoniae subsp. pneumoniae 1084
Pathway
kpp00010  Glycolysis / Gluconeogenesis
kpp00620  Pyruvate metabolism
kpp00640  Propanoate metabolism
kpp00680  Methane metabolism
kpp01100  Metabolic pathways
kpp01110  Biosynthesis of secondary metabolites
kpp01120  Microbial metabolism in diverse environments
kpp01130  Biosynthesis of antibiotics
kpp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A79E_4710
   00620 Pyruvate metabolism
    A79E_4710
   00640 Propanoate metabolism
    A79E_4710
  Energy metabolism
   00680 Methane metabolism
    A79E_4710
Enzymes [BR:kpp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     A79E_4710
Lipid biosynthesis proteins [BR:kpp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   A79E_4710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFQ67911
Position
4998296..5000254
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPANIAERCLINPDQYKAQYQQSITDPDTFWGEQGKILDWMRPYTRVKNTSF
APGNISIKWYEDGTLNLAANCLDRHLAERGDQTAIIWEGDDASQSKHITYRELHADVCRF
ANVLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGLRAGRAIPLKKNVDDALKNPNVKSIEHVVVLKRTGGNIDWQEGRDLWWSDL
IANASAEHRPVEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHKVSILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVMDTWWQTETGG
FMITPLPGAIELKAGSATRPFFGVQPVLVDNEGLPLDGATEGNLAIADSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPTPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAITMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaattcacaaacaccctattcccgctaatattgcggaacgttgcctgattaac
ccggatcagtacaaggcgcagtaccaacaatccataaccgaccctgatacattttggggc
gagcagggcaagatccttgactggatgcggccctatacccgtgtaaagaacacctccttc
gcaccgggtaatatttccatcaaatggtatgaagatggcaccctgaacctcgccgctaac
tgtctcgaccgccacctcgccgaacgcggcgatcaaaccgccatcatctgggaaggcgac
gacgccagccaaagcaagcacatcacctaccgtgaactgcatgcagacgtgtgccgtttc
gccaatgtgttgctcgacctcgggattaaaaaaggcgacgtggttgctatctatatgccg
atggtgccggaagccgcggtggcgatgctggcctgcgcccgcatcggggcaatccactcg
gtcattttcggcggcttctcgccggaggcggtggccggacgcattatcgactccagctca
cgcctggtgatcaccgctgacgaagggctgcgcgccggtcgcgccatcccgctgaagaaa
aacgtcgatgacgcgctgaaaaacccgaacgtgaaaagcattgagcacgtggtggtcctg
aaacgcaccggcggcaatatcgactggcaggaaggccgcgatctgtggtggagcgacctg
attgcgaacgccagcgccgaacaccggcccgtcgaaatgaacgccgaagatccgctgttc
atcctctatacctccggctccaccggtaaaccgaaaggggtgctgcacaccaccggcggc
tatctggtctatgcggccaccacctttaaatacgttttcgactaccatccgggcgatatt
tattggtgcaccgccgacgtgggctgggtcaccggccatagctatctgctgtacggccca
ctggcctgcggcgccaccaccctgatgttcgaaggggtgccgaactggcctacgccggcg
cgcatgtgccaggtcgtcgataagcataaggtcagcattctctataccgccccgacggct
attcgcgccctgatggcggaaggcgacaaagctatcgaaggcacagaccgctcctcgctg
cgcattcttggctcggtcggcgaaccgattaacccggaagcctgggagtggtactggaag
aagatcggtaacgagaagtgcccggtgatggacacctggtggcagaccgaaaccggcggc
tttatgatcactccgctgccgggcgcgattgagctgaaggccggctccgcgacgcgtccg
ttcttcggcgtccagccggtgctggtggataacgaaggcctgccgctggatggcgccacc
gagggcaacctcgccatcgccgactcctggcccggccaggcgcgtaccctgttcggcgac
catgagcgctttgagcaaacctacttctccaccttcaaaaatatgtactttagcggcgac
ggcgcgcgtcgtgatgaagatggctattactggatcaccggccgggtcgatgacgtcctg
aacgtctccggacaccgtctggggaccgccgagatcgaatcggcgctggtctcgcaccca
aaaatcgccgaagcggcggtggtggggatcccgcataacatcaaaggtcaggccatctat
gcctacgtgacgctcaatcacggcgaagaaccgacgccggagttgtatgccgaagtgcgt
aactgggtacgcaaagagatcggtccgctggcgacgccggatgtgctgcactggaccgat
tcgctgccgaaaacccgctcgggcaaaatcatgcgccgcattctgcgtaagattgccgca
ggcgacaccagcaacctcggcgatacctcgaccctcgccgatcctggcgtcgtggaaaaa
ctgctcgaagagaagcaggccattaccatgccatcgtaa

DBGET integrated database retrieval system