KEGG   Klebsiella pneumoniae subsp. pneumoniae KPR0928: KPR0928_04195Help
Entry
KPR0928_04195     CDS       T03371                                 

Definition
(GenBank) N-acetyl-anhydromuranmyl-L-alanine amidase
  KO
K03806  N-acetyl-anhydromuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
kpq  Klebsiella pneumoniae subsp. pneumoniae KPR0928
Brite
KEGG Orthology (KO) [BR:kpq00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpq01011]
    KPR0928_04195
Enzymes [BR:kpq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     KPR0928_04195
Peptidoglycan biosynthesis and degradation proteins [BR:kpq01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   KPR0928_04195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_2
Motif
Other DBs
NCBI-ProteinID: AIE26866
Position
882660..883223
Genome map
AA seq 187 aa AA seqDB search
MQLNEGWLVGARRVPSPHHDCRPDEETPSLLVVHNISLPPGEFGGPWIDALFTGTLDPHA
HPFFAEIAHLRVSAHCLIRRDGEIVQYVPFDKRAWHAGVSCYQGRERCNDFSIGIELEGT
DTLAYTDAQYRQLAAVTDLLIALYPAIAENIAGHSDIAPVRKTDPGPAFDWIKYRALLSA
PSEKETS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgaacgaggggtggttggtcggcgcgcgtcgggttccctcgccgcaccatgac
tgccgtccggatgaagagaccccttccttactggtggtgcataacattagcctgccaccg
ggggaatttggtggtccgtggattgatgcgctgttcactggtaccctggatccgcacgcg
catcctttctttgccgagattgctcatctgcgcgtttcggcgcattgtctgattcgccgt
gatggcgaaatcgtgcagtatgtgcctttcgataagcgggcgtggcatgcgggcgtctcc
tgttatcagggacgcgaacgctgcaatgacttttccatcggcatagagctggaaggcacc
gatactctggcgtataccgacgcgcagtaccggcagctggcggcggtgacggatctgctg
atcgcgctttatccggctatcgccgaaaacattgcgggccacagcgatatcgcgcccgtg
cggaaaaccgatccaggaccggcctttgactggataaaataccgtgcgctgctcagcgcc
ccgtcagaaaaggagacctcatga

DBGET integrated database retrieval system