KEGG   Klebsiella pneumoniae subsp. pneumoniae KPR0928: KPR0928_07435Help
Entry
KPR0928_07435     CDS       T03371                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
kpq  Klebsiella pneumoniae subsp. pneumoniae KPR0928
Pathway
kpq00860  Porphyrin and chlorophyll metabolism
kpq01100  Metabolic pathways
Module
kpq_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:kpq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KPR0928_07435
Enzymes [BR:kpq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     KPR0928_07435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AIE27482
Position
complement(1547340..1547969)
Genome map
AA seq 209 aa AA seqDB search
MKLWLVRHGETEANVAGLYSGHAPTPLTPRGVAQARALGERLRLAPFDKVFCSELARTGT
TADLLLGDRAIPRERHPALNEMFFGDWEMRHHRDLQREDAENYAAWCADWQHAAPTNGES
FQNFARRVSEFIPTLTDCRHLDHLLIVGHQGVLSLLTALLLQMPAAAMWHFPIAHGAWSL
LEIRDDFTTLRVLNSQAVWRPQEEFPPDH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtggttagttcgccatggcgaaaccgaagccaacgttgccgggttatacagc
ggccatgccccaacgcccctgacgccgcgcggcgtcgctcaggcgcgcgcgctcggcgaa
cggctgcgcctggcgcctttcgataaagtattctgtagcgagctggcgcggaccgggaca
acggccgatctgctgcttggcgaccgcgctattccgcgtgagcgccatcccgcgctcaat
gagatgtttttcggcgactgggagatgcgtcatcatcgcgacctccagcgagaagatgcg
gaaaactatgccgcctggtgtgccgactggcagcatgcggcccccaccaacggcgaaagc
tttcagaattttgcccgccgcgtcagcgagtttatcccaacgctgaccgactgccgccat
cttgaccatctgctgatcgtcggccatcagggcgtcctgagcctgctgaccgccctgctg
ttgcagatgcctgcggcggcgatgtggcactttcccattgcccatggcgcctggagcctc
ctcgaaatccgcgacgatttcaccaccctgcgggtattaaatagccaggccgtctggcgg
ccgcaagaagaattcccgccagaccattga

DBGET integrated database retrieval system