KEGG   Klebsiella pneumoniae subsp. pneumoniae KPR0928: KPR0928_12865Help
Entry
KPR0928_12865     CDS       T03371                                 

Definition
(GenBank) trans-aconitate methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
kpq  Klebsiella pneumoniae subsp. pneumoniae KPR0928
Brite
KEGG Orthology (KO) [BR:kpq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KPR0928_12865
Enzymes [BR:kpq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     KPR0928_12865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_12 FtsJ MTS DUF3843 Methyltransf_33
Motif
Other DBs
NCBI-ProteinID: AIE28500
Position
complement(2626590..2627351)
Genome map
AA seq 253 aa AA seqDB search
MADWNPSLYLQFDAERTRPAADLLSRIAHLQVEHAVDLGCGPGNSTRLLRAAWPLATIVG
IDNSPAMLVQAAQALPDCEFIDADIARWRPAQPPDVIYANASLQWLTDHETLFPHLVNQL
ADNGTLAVQMPDNWQEPSHTLMRQVASEMGLPDRGRQPLLPPAAWYDLLSRQSCEVDIWR
TTYFHPLASHQAIVDWLQGTGLRPYLAGLDEQAGSAFLTRYLALLAAYYPLQCNGKVLLR
FPRLFIVARKIAA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccgactggaatccttcgttgtatctgcaatttgacgctgaacgtacccgccccgcg
gccgacctgctctcgcgtattgcccatctgcaggtcgagcacgccgtcgacctcggctgc
gggccgggaaacagcacccgcctgctacgcgccgcctggccgttggcgacgatcgtcggt
atcgataactccccggccatgctggtccaggcggcgcaggccttgcccgactgcgaattc
attgatgccgatattgcccgctggcggcctgcgcaaccgccagatgtgatctatgccaac
gcctctctgcagtggctgacggatcatgagacgcttttcccccatctggtaaaccagctg
gcggacaacggaacgctggcagtgcagatgccggataactggcaggaaccttcccatacc
ctgatgcgtcaggttgccagcgagatggggttgccggaccgtggacgccagccgttactc
ccgcccgccgcctggtacgatctgctcagccgccagagttgcgaagttgatatctggcgc
accacctattttcatccccttgcttctcatcaggcgattgtcgactggctgcagggcacc
gggttacgcccctatctggcaggcctggacgagcaggccggaagcgcgtttctcacacgc
tatctcgcattgctggccgcatactatccgttacagtgtaacgggaaggtgctcctgcgt
ttcccacggctgtttatcgtggcgcgaaagatcgccgcctga

DBGET integrated database retrieval system