KEGG   Klebsiella pneumoniae subsp. pneumoniae KPR0928: KPR0928_21080Help
Entry
KPR0928_21080     CDS       T03371                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpq  Klebsiella pneumoniae subsp. pneumoniae KPR0928
Pathway
kpq00071  Fatty acid degradation
kpq00072  Synthesis and degradation of ketone bodies
kpq00280  Valine, leucine and isoleucine degradation
kpq00310  Lysine degradation
kpq00362  Benzoate degradation
kpq00380  Tryptophan metabolism
kpq00620  Pyruvate metabolism
kpq00630  Glyoxylate and dicarboxylate metabolism
kpq00640  Propanoate metabolism
kpq00650  Butanoate metabolism
kpq00900  Terpenoid backbone biosynthesis
kpq01100  Metabolic pathways
kpq01110  Biosynthesis of secondary metabolites
kpq01120  Microbial metabolism in diverse environments
kpq01130  Biosynthesis of antibiotics
kpq01200  Carbon metabolism
kpq01212  Fatty acid metabolism
kpq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPR0928_21080
   00630 Glyoxylate and dicarboxylate metabolism
    KPR0928_21080
   00640 Propanoate metabolism
    KPR0928_21080
   00650 Butanoate metabolism
    KPR0928_21080
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KPR0928_21080
   00072 Synthesis and degradation of ketone bodies
    KPR0928_21080
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPR0928_21080
   00310 Lysine degradation
    KPR0928_21080
   00380 Tryptophan metabolism
    KPR0928_21080
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPR0928_21080
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPR0928_21080
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPR0928_21080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpq04147]
    KPR0928_21080
Enzymes [BR:kpq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPR0928_21080
Exosome [BR:kpq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPR0928_21080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIE30069
Position
complement(4346204..4347382)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTPIGCFQGALSRHSAVELGSVVVKALVEKTGIDPHSVDEVILGQVLTAG
TGQNPARQSAIRGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREFGISRELQDAWAL
SSQHKARKAIDSGRFRDEIVPVVTEHNGAARTVDTDEQPRVDASAEGLASLQPTFDRLGS
VTAGNASSINDGAAAVMMMSEAKALELGLPILARIRAFASVGVDPALMGIAPVHATRRCL
ERAGWRLDDVDLIEANEAFAAQAISVGRVLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMIKRDARKGLATLCIGGGQGVALAVERA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatgtcgtgatcgtcggcgcgctgcgaacgccgattggctgctttcagggcgca
ttatcgcgccattcagccgtcgagctggggagcgtggtggtgaaggcgctggtggagaaa
acgggaatcgatccgcacagcgtggatgaggtgatcctcggccaggtgctgaccgcgggg
accggacaaaatccggcgcgtcagtccgctattcgcggtgggctgcctaacaccgtatcg
gctatcaccattaacgatgtctgcggttccggcctgaaggctctgcacctcgctacccag
gcgatccagtgcggggaagcggacgtggtgatcgctggcggccaggagaatatgagccgc
gctccgcatgtgcttaccgacagccgcaccggcgcccagctgggcaacagccagctgatt
gacagtctggtgcatgatgggctgtgggatgctttcaacgattatcatatgggcgtcacg
gcggaaaacctggcccgggaatttggcatcagtcgcgagctgcaggacgcctgggcgctc
agctcacagcataaggcgcgcaaggcgattgattccggtcgctttcgcgatgagatcgtc
ccggttgtcaccgagcataacggcgcggcgcgcaccgtggataccgatgaacaaccgcgg
gtggatgccagcgcggaagggctggccagcctgcagcccaccttcgatcgccttggatcg
gtaaccgccggcaacgcctcaagcatcaatgacggcgcggcggcggtaatgatgatgagc
gaggctaaagcgctggagctggggctgccgatccttgcgcggatccgcgccttcgccagc
gtcggcgtcgatccggcgctgatgggcattgccccggtgcatgccacccgtcgctgtctg
gagcgggccggctggcggctggacgacgtcgatctgatcgaagccaatgaggcctttgcc
gctcaggcgatctcggttggccgggtactggagtgggatgagcgccgggtcaacgtcaac
ggcggcgcgatcgccctcggccaccccatcggcgcctccggctgccggattctggtgtcg
ctggtgcatgaaatgatcaagcgcgatgcccgcaaaggtctggcgacgctgtgcattggc
ggcggtcagggcgtggcgctggcggtagaacgcgcatag

DBGET integrated database retrieval system