KEGG   Klebsiella pneumoniae subsp. pneumoniae KPR0928: KPR0928_22555Help
Entry
KPR0928_22555     CDS       T03371                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
kpq  Klebsiella pneumoniae subsp. pneumoniae KPR0928
Pathway
kpq00561  Glycerolipid metabolism
kpq00640  Propanoate metabolism
kpq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KPR0928_22555 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    KPR0928_22555 (gldA)
Enzymes [BR:kpq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     KPR0928_22555 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 PFK FAD_binding_4 RibD_C
Motif
Other DBs
NCBI-ProteinID: AIE30348
Position
complement(4624859..4625956)
Genome map
AA seq 365 aa AA seqDB search
MLKVIQSPAKYLQGPDAAVLFGQYAKNLAESFFVIADDFVMKLAGEKVVNGLQSHDIRCH
AERFNGECSHAEINRLMAILQKQGCRGVVGIGGGKTLDTAKAIGYYQKLPVVVIPTIAST
DAPTSALSVIYTEAGEFEEYLIYPKNPDMVVMDTAIIAKAPVRLLVSGMGDALSTWFEAK
ACYDARATSMAGGQSTEAALSLARLCYDTLLAEGEKARLAAQAGVVTEALERIIEANTYL
SGIGFESSGLAAAHAIHNGFTILEECHHLYHGEKVAFGTLAQLVLQNSPMDEIETVLGFC
QRVGLPVTLAQMGVKEGIDEKIAAVAKATCAEGETIHNMPFAVTPESVHAAILTADLLGQ
QWLAR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagttattcaatctccagccaaatatcttcagggtcctgatgctgctgttctg
ttcggtcaatatgccaaaaacctggcggagagcttcttcgtcatcgccgacgatttcgta
atgaagctggcgggagagaaagtggtgaatggcctgcagagccacgatattcgctgccat
gcggaacggtttaacggtgaatgcagccatgcggaaatcaaccgtctgatggcgattttg
caaaaacagggctgccgcggcgtggtcgggatcggcggtggtaaaaccctcgataccgcg
aaggcgatcggttactaccagaagctgccggtggtggtgatcccgaccatcgcctcgacc
gatgcgccgaccagcgcgctgtcggtgatctacaccgaagcgggcgagtttgaagagtat
ctgatctatccgaaaaacccggatatggtggtgatggacacggcgattatcgccaaagcg
ccggtacgcctgctggtctccggcatgggcgatgcgctctccacctggttcgaggccaaa
gcttgctacgatgcgcgcgccaccagcatggccggaggacagtccaccgaggcggcgctg
agcctcgcccgcctgtgctatgatacgctgctggcggagggcgaaaaggcccgtctggcg
gcgcaggccggggtagtgaccgaagcgctggagcgcatcatcgaggcgaacacttacctc
agcggcattggctttgaaagcagtggcctggccgctgcccatgcaatccacaacggtttc
accattcttgaagagtgccatcacctgtatcacggtgagaaagtggccttcggtaccctg
gcgcagctggtgctgcagaacagcccgatggacgagattgaaacggtgctgggcttctgc
cagcgcgtcggcctgccggtgacgctcgcgcagatgggcgtcaaagaggggatcgacgag
aaaatcgccgcggtggcgaaagctacctgcgcggaaggggaaaccatccataatatgccg
tttgcggtgaccccggagagcgtccatgccgctatcctcaccgccgatctgttaggccag
cagtggctggcgcgttaa

DBGET integrated database retrieval system