KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_0387Help
Entry
KPR_0387          CDS       T02793                                 

Gene name
sorA
Definition
(GenBank) highly similar to sorbose-specific phosphotransferase enzyme IIB component from Klebsiella pneumoniae (sp|P37081)
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00051  Fructose and mannose metabolism
kpr01100  Metabolic pathways
kpr02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPR_0387 (sorA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    KPR_0387 (sorA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kpr02000]
    KPR_0387 (sorA)
Enzymes [BR:kpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     KPR_0387 (sorA)
Transporters [BR:kpr02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    KPR_0387 (sorA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: CCI74619
UniProt: R4Y7R3
Structure
PDB: 

Position
complement(423828..424325)
Genome map
AA seq 165 aa AA seqDB search
MMQITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVFNDEVRRTLLRQAAPPGMKVNV
VSLEKAVAVYHNPQYQDETVFYLFTNPHDVLTMVRQGVQIATLNIGGMAWRPGKKQLTKA
VSLDPQDIQAFRELDKLGVKLDLRVVASDPSVNILDKINETAFCE
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
ctgatgcaaattaccctcgcccgtattgatgaccgactgattcatggccaggtcaccacc
gtgtggtcaaaagtcgccaacgcccagcggataattatctgcaatgacgatgtatttaac
gatgaggttcgccggaccctgttgcgccaggcggctccgccaggcatgaaggtaaacgtt
gtcagtctggaaaaagcggttgcggtctatcataacccgcaatatcaggacgagaccgtc
ttttatttatttaccaatccacacgatgttttaacgatggtgcgccagggcgtgcagatc
gccacgttaaatattggtggcatggcctggcgacccggtaaaaaacagctaaccaaagcc
gtttctttggatccgcaggatattcaggcattccgtgaactcgataaactgggcgtaaaa
ctcgatttacgcgtggtcgcatcagatccgtcagtcaatattctcgacaaaattaacgaa
acagctttctgcgaataa

DBGET integrated database retrieval system