KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_1020Help
Entry
KPR_1020          CDS       T02793                                 

Gene name
murD
Definition
(GenBank) highly similar to UDP-N-acetylmuramoylalanine--D-glutamate ligase from Salmonella typhimurium (sp|Q8ZRU4)
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00471  D-Glutamine and D-glutamate metabolism
kpr00550  Peptidoglycan biosynthesis
kpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    KPR_1020 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KPR_1020 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpr01011]
    KPR_1020 (murD)
Enzymes [BR:kpr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     KPR_1020 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:kpr01011]
 Precursor biosynthesis
  Amino acid ligase
   KPR_1020 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: CCI75250
UniProt: R4YC40
Position
1069008..1070324
Genome map
AA seq 438 aa AA seqDB search
MADYQGKKVVIIGLGMTGLSCVDFFMARGVTPRVMDTRVAPPGLDKLPESVECHVGGLND
TWLLAADLIVASPGIALAHPSLSAAADAGVEIVGDIELFCREAQAPIIAITGSNGKSTVT
TLVGEMAKAAGINVGVGGNIGLPALMLLDTDRELYVLELSSFQLETTSSLQAVAATILNV
TEDHMDRYPLGLQQYRAAKLRIYENAKTCVVNADDALTMPVRGADERCISFGVDVGDYHL
NRQQGETWLRVKGEKVLNVKEMPLTGQHNYSNALAALALADAAGLPRASSLKVLTTFTGL
AHRFQLVLDHNGVRWINDSKATNVGSTEAALNGLQLDGTLYLLLGGDGKSADFTPLKRYL
GGDRIRLYCFGRDGAELAELRPEVAVQTETMEQAMRQIAPLVKAGDMVLLSPACASLDQF
KNFEQRGEMFARLAKELG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcagattatcagggtaaaaaagtcgtcataattgggctgggcatgaccggcctgtca
tgcgtggactttttcatggcgcgcggcgtaaccccgcgcgtgatggacacccgcgtcgcg
cctccggggctggataaattacccgaatcggtcgaatgccatgtcggcggactcaatgat
acctggctgctggcggcggacctgattgtcgccagtccggggattgcgctggcccatcct
tcgctcagcgcagcggccgacgctggcgtagagatcgttggcgatatcgaactgttctgc
cgcgaagcgcaggcgccgattatcgccattaccggttctaacggcaaaagcactgttact
accctggtgggcgagatggcgaaagccgctggaattaacgtcggcgtgggcggcaatatc
ggcctgccggcgctgatgttgctggacaccgatcgagagctgtatgtgctggagctctcc
agcttccagctggaaaccacctccagcctgcaggcggtggcggcaaccatcctcaacgtg
actgaggaccatatggaccgctacccgctggggctgcagcagtatcgcgcggcgaagctg
cggatttacgagaatgcgaagacctgcgtggtgaatgcggacgatgcgctcaccatgccg
gtacgcggggcggacgaacgctgcattagctttggcgtcgatgtcggtgactaccacctt
aaccgccagcagggcgaaacctggctgcgcgttaaaggtgagaaagtcctcaatgtgaaa
gagatgcctctcaccggtcagcataactacagcaacgccctggcggcgctggcgctggcc
gatgccgcgggtctgccgcgggccagcagcctgaaggtgctgaccacctttaccggtctg
gcgcaccgtttccagctggtgctggatcacaacggcgtacgctggattaacgactcgaag
gctaccaacgtcggcagcaccgaggcggcgctgaacggcctgcagctggacggcacgctc
tatctgctgctgggcggcgacggcaagtccgctgattttaccccgctgaagcgctacctc
ggcggcgatcgtattcgcctgtactgctttggtcgcgatggcgccgagctcgctgagctg
cgtcctgaggtggcggtacaaactgagactatggaacaggcgatgcgtcagattgctccc
ctggtgaaagcgggggacatggtgctcctgtcgccggcctgcgctagcctggatcagttt
aagaactttgaacaacggggcgagatgtttgcccgtctggcgaaggagttaggttga

DBGET integrated database retrieval system